BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV12l12r (753 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292372-1|CAL23184.2| 771|Tribolium castaneum gustatory recept... 31 0.013 DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase rever... 21 8.0 >AM292372-1|CAL23184.2| 771|Tribolium castaneum gustatory receptor candidate 51 protein. Length = 771 Score = 30.7 bits (66), Expect = 0.013 Identities = 16/57 (28%), Positives = 31/57 (54%), Gaps = 3/57 (5%) Frame = -3 Query: 235 KLMKNYEFFCIMRYIWLTKYQSHGMRCF---EAQLFVKKPLFCNLKHIFYQILYNSI 74 KLMKN+ F+ +++ + Y ++G++ F + F K L L ++Y+ L S+ Sbjct: 132 KLMKNFYFWFVLKQVMFLCYSTYGIQVFGTMQRTSFFKTFLNSCLMDVYYEFLLISL 188 >DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase reverse transcriptase protein. Length = 596 Score = 21.4 bits (43), Expect = 8.0 Identities = 10/34 (29%), Positives = 19/34 (55%) Frame = +2 Query: 128 FFYK*LCFETSHSMRLIFR*PYVSHDAKKLIIFH 229 F+YK + H ++ I + Y+S ++K +FH Sbjct: 133 FYYKPIKTLNGHEIKFIRKEEYISFESK---VFH 163 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 159,041 Number of Sequences: 336 Number of extensions: 3421 Number of successful extensions: 6 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20131186 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -