BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV12l11r (745 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_A5FL37 Cluster: Putative uncharacterized protein precur... 33 5.6 >UniRef50_A5FL37 Cluster: Putative uncharacterized protein precursor; n=1; Flavobacterium johnsoniae UW101|Rep: Putative uncharacterized protein precursor - Flavobacterium johnsoniae UW101 Length = 144 Score = 33.5 bits (73), Expect = 5.6 Identities = 32/124 (25%), Positives = 53/124 (42%), Gaps = 2/124 (1%) Frame = +2 Query: 8 IKVLISYELTVLYGLISAKSKSNRYTAKNIKHSRLGLFHCETETRLHITPSQIFASI*VN 187 I ++++ L VL +I K+K K +K + E + T S +F N Sbjct: 14 IMLVVTASLCVLAVIIKMKNKKG---PKLLKRDKYNSTMTEKMVEVKKTDSNVF-----N 65 Query: 188 ITWDAAVRFQSHRQQSLPTKDKDTFTPIFRNIDGRFKIILLYVEQKKR--STVAKPNRGR 361 I W R +S + S KD+D ++R+ +F+ ILL E K S + R + Sbjct: 66 I-WPYVSRLKSAKILSKKIKDQDLIYKVYRDSSQKFEHILLSTEDKNNFVSIIVNKKRRK 124 Query: 362 ALIY 373 + Y Sbjct: 125 TIGY 128 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 667,194,408 Number of Sequences: 1657284 Number of extensions: 12544739 Number of successful extensions: 25710 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 24932 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 25707 length of database: 575,637,011 effective HSP length: 99 effective length of database: 411,565,895 effective search space used: 60911752460 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -