BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV12l09r (783 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase ... 23 4.2 DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase ... 23 4.2 AY661557-1|AAT74557.1| 411|Apis mellifera yellow-f-like protein... 22 5.6 EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. 22 7.4 AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. 22 7.4 >DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase isoform B protein. Length = 931 Score = 22.6 bits (46), Expect = 4.2 Identities = 11/29 (37%), Positives = 13/29 (44%) Frame = -3 Query: 355 VERSKGGGFVLFKFYFLIHILLLHTYYCG 269 ++ S GGGF LI L YCG Sbjct: 661 IDHSYGGGFGFGSAVLLISDRLSRDLYCG 689 >DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase isoform A protein. Length = 969 Score = 22.6 bits (46), Expect = 4.2 Identities = 11/29 (37%), Positives = 13/29 (44%) Frame = -3 Query: 355 VERSKGGGFVLFKFYFLIHILLLHTYYCG 269 ++ S GGGF LI L YCG Sbjct: 699 IDHSYGGGFGFGSAVLLISDRLSRDLYCG 727 >AY661557-1|AAT74557.1| 411|Apis mellifera yellow-f-like protein protein. Length = 411 Score = 22.2 bits (45), Expect = 5.6 Identities = 12/46 (26%), Positives = 22/46 (47%) Frame = +3 Query: 381 VASYNQLTKFRANTYVD*FQCNTIHTLVNILYIYFKNNSTYIIICN 518 +A ++ T+ NT++ + NT N L I N+ Y++ N Sbjct: 321 IACWDTNTELNPNTFILVAENNTTMVFCNDLSIDRSTNTMYVLSDN 366 >EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. Length = 683 Score = 21.8 bits (44), Expect = 7.4 Identities = 7/15 (46%), Positives = 11/15 (73%) Frame = -3 Query: 319 KFYFLIHILLLHTYY 275 +FYF +H +L+ YY Sbjct: 256 EFYFFLHKQVLNRYY 270 >AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. Length = 683 Score = 21.8 bits (44), Expect = 7.4 Identities = 7/15 (46%), Positives = 11/15 (73%) Frame = -3 Query: 319 KFYFLIHILLLHTYY 275 +FYF +H +L+ YY Sbjct: 256 EFYFFLHKQVLNRYY 270 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 191,309 Number of Sequences: 438 Number of extensions: 4123 Number of successful extensions: 10 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 24639531 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -