BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV12l09f (582 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g33450.1 68417.m04752 myb family transcription factor (MYB69)... 28 5.2 At5g54020.1 68418.m06719 expressed protein 27 6.9 >At4g33450.1 68417.m04752 myb family transcription factor (MYB69) contains PFAM profile: Myb DNA binding domain PF00249; identical to cDNA putative transcription factor (MYB69) mRNA, partial cds GI:3941495 Length = 250 Score = 27.9 bits (59), Expect = 5.2 Identities = 15/46 (32%), Positives = 21/46 (45%) Frame = -2 Query: 281 SLFRLLWSSF*APSPALALLTHQEDRSHRPRKERICSLLPHRRNSP 144 S F W + +PS +L L R RK++ C L P+ SP Sbjct: 130 STFNQTWHTVLSPSSSLTRLNRSHFGLWRYRKDKSCGLWPYSFVSP 175 >At5g54020.1 68418.m06719 expressed protein Length = 556 Score = 27.5 bits (58), Expect = 6.9 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = +3 Query: 60 DKMSPY*CAESNPITSKYCVIKSSR 134 D +PY C E N + KYC+ K R Sbjct: 154 DDRNPYVCLECNLMVHKYCIEKLPR 178 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,630,409 Number of Sequences: 28952 Number of extensions: 186325 Number of successful extensions: 350 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 346 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 350 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1141585696 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -