BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV12l07f (553 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC033682-1|AAH33682.1| 550|Homo sapiens solute carrier family 2... 32 1.2 AJ271205-1|CAB97249.1| 519|Homo sapiens putative organic anion ... 32 1.2 AJ251529-1|CAB94830.1| 506|Homo sapiens putative organic anion ... 32 1.2 AJ249369-1|CAB77184.1| 563|Homo sapiens organic anion transport... 32 1.2 AF124373-1|AAD55356.1| 550|Homo sapiens organic anion transport... 32 1.2 AF104038-1|AAD10052.1| 550|Homo sapiens para-aminohippurate tra... 32 1.2 AF097490-1|AAD19356.1| 550|Homo sapiens organic anion transport... 32 1.2 AF057039-1|AAC70004.1| 550|Homo sapiens putative renal organic ... 32 1.2 AB009698-1|BAA75073.1| 550|Homo sapiens hOAT1-2 protein. 32 1.2 AB009697-1|BAA75072.1| 563|Homo sapiens hOAT1-1 protein. 32 1.2 AB018263-1|BAA34440.2| 1091|Homo sapiens KIAA0720 protein protein. 32 1.5 AK125693-1|BAC86247.1| 321|Homo sapiens protein ( Homo sapiens ... 31 2.7 AB051472-1|BAB21776.2| 1505|Homo sapiens KIAA1685 protein protein. 30 4.7 U52962-1|AAD10838.1| 3321|Homo sapiens kendrin protein. 30 6.2 AF515282-1|AAP46636.1| 3336|Homo sapiens pericentrin B protein. 30 6.2 AB007862-1|BAA23698.3| 3284|Homo sapiens KIAA0402 protein. 30 6.2 >BC033682-1|AAH33682.1| 550|Homo sapiens solute carrier family 22 (organic anion transporter), member 6 protein. Length = 550 Score = 32.3 bits (70), Expect = 1.2 Identities = 16/41 (39%), Positives = 23/41 (56%) Frame = +3 Query: 420 LICPPVKHMCICL*LRRFKFKKQYYSLLMDLYSRLLIKIYL 542 L CP ++H+ +CL + F YY L+MDL + IYL Sbjct: 330 LRCPTLRHLFLCLSMLWFATSFAYYGLVMDLQG-FGVSIYL 369 >AJ271205-1|CAB97249.1| 519|Homo sapiens putative organic anion transporter protein. Length = 519 Score = 32.3 bits (70), Expect = 1.2 Identities = 16/41 (39%), Positives = 23/41 (56%) Frame = +3 Query: 420 LICPPVKHMCICL*LRRFKFKKQYYSLLMDLYSRLLIKIYL 542 L CP ++H+ +CL + F YY L+MDL + IYL Sbjct: 330 LRCPTLRHLFLCLSMLWFATSFAYYGLVMDLQG-FGVSIYL 369 >AJ251529-1|CAB94830.1| 506|Homo sapiens putative organic anion transporter protein. Length = 506 Score = 32.3 bits (70), Expect = 1.2 Identities = 16/41 (39%), Positives = 23/41 (56%) Frame = +3 Query: 420 LICPPVKHMCICL*LRRFKFKKQYYSLLMDLYSRLLIKIYL 542 L CP ++H+ +CL + F YY L+MDL + IYL Sbjct: 330 LRCPTLRHLFLCLSMLWFATSFAYYGLVMDLQG-FGVSIYL 369 >AJ249369-1|CAB77184.1| 563|Homo sapiens organic anion transporter protein. Length = 563 Score = 32.3 bits (70), Expect = 1.2 Identities = 16/41 (39%), Positives = 23/41 (56%) Frame = +3 Query: 420 LICPPVKHMCICL*LRRFKFKKQYYSLLMDLYSRLLIKIYL 542 L CP ++H+ +CL + F YY L+MDL + IYL Sbjct: 330 LRCPTLRHLFLCLSMLWFATSFAYYGLVMDLQG-FGVSIYL 369 >AF124373-1|AAD55356.1| 550|Homo sapiens organic anion transporter 1 protein. Length = 550 Score = 32.3 bits (70), Expect = 1.2 Identities = 16/41 (39%), Positives = 23/41 (56%) Frame = +3 Query: 420 LICPPVKHMCICL*LRRFKFKKQYYSLLMDLYSRLLIKIYL 542 L CP ++H+ +CL + F YY L+MDL + IYL Sbjct: 330 LRCPTLRHLFLCLSMLWFATSFAYYGLVMDLQG-FGVSIYL 369 >AF104038-1|AAD10052.1| 550|Homo sapiens para-aminohippurate transporter protein. Length = 550 Score = 32.3 bits (70), Expect = 1.2 Identities = 16/41 (39%), Positives = 23/41 (56%) Frame = +3 Query: 420 LICPPVKHMCICL*LRRFKFKKQYYSLLMDLYSRLLIKIYL 542 L CP ++H+ +CL + F YY L+MDL + IYL Sbjct: 330 LRCPTLRHLFLCLSMLWFATSFAYYGLVMDLQG-FGVSIYL 369 >AF097490-1|AAD19356.1| 550|Homo sapiens organic anion transporter 1 protein. Length = 550 Score = 32.3 bits (70), Expect = 1.2 Identities = 16/41 (39%), Positives = 23/41 (56%) Frame = +3 Query: 420 LICPPVKHMCICL*LRRFKFKKQYYSLLMDLYSRLLIKIYL 542 L CP ++H+ +CL + F YY L+MDL + IYL Sbjct: 330 LRCPTLRHLFLCLSMLWFATSFAYYGLVMDLQG-FGVSIYL 369 >AF057039-1|AAC70004.1| 550|Homo sapiens putative renal organic anion transporter 1 protein. Length = 550 Score = 32.3 bits (70), Expect = 1.2 Identities = 16/41 (39%), Positives = 23/41 (56%) Frame = +3 Query: 420 LICPPVKHMCICL*LRRFKFKKQYYSLLMDLYSRLLIKIYL 542 L CP ++H+ +CL + F YY L+MDL + IYL Sbjct: 330 LRCPTLRHLFLCLSMLWFATSFAYYGLVMDLQG-FGVSIYL 369 >AB009698-1|BAA75073.1| 550|Homo sapiens hOAT1-2 protein. Length = 550 Score = 32.3 bits (70), Expect = 1.2 Identities = 16/41 (39%), Positives = 23/41 (56%) Frame = +3 Query: 420 LICPPVKHMCICL*LRRFKFKKQYYSLLMDLYSRLLIKIYL 542 L CP ++H+ +CL + F YY L+MDL + IYL Sbjct: 330 LRCPTLRHLFLCLSMLWFATSFAYYGLVMDLQG-FGVSIYL 369 >AB009697-1|BAA75072.1| 563|Homo sapiens hOAT1-1 protein. Length = 563 Score = 32.3 bits (70), Expect = 1.2 Identities = 16/41 (39%), Positives = 23/41 (56%) Frame = +3 Query: 420 LICPPVKHMCICL*LRRFKFKKQYYSLLMDLYSRLLIKIYL 542 L CP ++H+ +CL + F YY L+MDL + IYL Sbjct: 330 LRCPTLRHLFLCLSMLWFATSFAYYGLVMDLQG-FGVSIYL 369 >AB018263-1|BAA34440.2| 1091|Homo sapiens KIAA0720 protein protein. Length = 1091 Score = 31.9 bits (69), Expect = 1.5 Identities = 17/53 (32%), Positives = 22/53 (41%) Frame = +3 Query: 270 GRPSPGSRGVPVRDRPPCRGRGRFNFRHSPVQKLGTKRISLQCTNLGTLRLIC 428 G P PG G P R PP R SP +K G + + C + G +C Sbjct: 6 GLPVPGVPGAPARRPPPARHGACSMDDQSPAEKKGLRCQNPACMDKGRAAKVC 58 >AK125693-1|BAC86247.1| 321|Homo sapiens protein ( Homo sapiens cDNA FLJ43705 fis, clone TESOP2001818. ). Length = 321 Score = 31.1 bits (67), Expect = 2.7 Identities = 17/39 (43%), Positives = 21/39 (53%) Frame = +3 Query: 222 AGCQREVHGARR*TRQGRPSPGSRGVPVRDRPPCRGRGR 338 AGC+ + G R T +GR SP + GVP R P R R Sbjct: 133 AGCRTQARGQRL-TSRGRESPEATGVPERRGDPETRRNR 170 >AB051472-1|BAB21776.2| 1505|Homo sapiens KIAA1685 protein protein. Length = 1505 Score = 30.3 bits (65), Expect = 4.7 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = +3 Query: 270 GRPSPGSRGVPVRDRPPCRGRGR 338 GRP PG +PV RP R +GR Sbjct: 54 GRPEPGHGSLPVSSRPDMREKGR 76 >U52962-1|AAD10838.1| 3321|Homo sapiens kendrin protein. Length = 3321 Score = 29.9 bits (64), Expect = 6.2 Identities = 13/29 (44%), Positives = 16/29 (55%) Frame = -2 Query: 324 DKADGRELGHPYFPGSDGPDASTGGRRVP 238 +K+DG G PGS GP+A T G P Sbjct: 2329 EKSDGSGFGARLSPGSGGPEAQTAGPVTP 2357 >AF515282-1|AAP46636.1| 3336|Homo sapiens pericentrin B protein. Length = 3336 Score = 29.9 bits (64), Expect = 6.2 Identities = 13/29 (44%), Positives = 16/29 (55%) Frame = -2 Query: 324 DKADGRELGHPYFPGSDGPDASTGGRRVP 238 +K+DG G PGS GP+A T G P Sbjct: 2340 EKSDGSGFGARLSPGSGGPEAQTAGPVTP 2368 >AB007862-1|BAA23698.3| 3284|Homo sapiens KIAA0402 protein. Length = 3284 Score = 29.9 bits (64), Expect = 6.2 Identities = 13/29 (44%), Positives = 16/29 (55%) Frame = -2 Query: 324 DKADGRELGHPYFPGSDGPDASTGGRRVP 238 +K+DG G PGS GP+A T G P Sbjct: 2367 EKSDGSGFGARLSPGSGGPEAQTAGPVTP 2395 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 67,308,655 Number of Sequences: 237096 Number of extensions: 1345613 Number of successful extensions: 8352 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 7344 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8319 length of database: 76,859,062 effective HSP length: 86 effective length of database: 56,468,806 effective search space used: 5477474182 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -