BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV12l06r (748 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_51931| Best HMM Match : Ribosomal_L3 (HMM E-Value=0) 244 8e-65 SB_14332| Best HMM Match : Ribosomal_L3 (HMM E-Value=8.6e-34) 140 1e-33 SB_7140| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_22251| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_51282| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.0 SB_6540| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.3 SB_35285| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.0 SB_22404| Best HMM Match : SNF2_N (HMM E-Value=0) 28 7.0 SB_11005| Best HMM Match : SspH (HMM E-Value=0.85) 28 7.0 SB_5912| Best HMM Match : 7tm_1 (HMM E-Value=7.3e-08) 28 7.0 SB_57037| Best HMM Match : RVT_1 (HMM E-Value=3.4e-15) 28 9.2 SB_56220| Best HMM Match : RVT_1 (HMM E-Value=3.7e-16) 28 9.2 SB_37487| Best HMM Match : RVT_1 (HMM E-Value=0.03) 28 9.2 SB_33284| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.2 SB_30332| Best HMM Match : RVT_1 (HMM E-Value=2.7e-34) 28 9.2 SB_28979| Best HMM Match : RVT_1 (HMM E-Value=1.6e-40) 28 9.2 SB_26992| Best HMM Match : rve (HMM E-Value=6.3e-36) 28 9.2 SB_26886| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.2 SB_51232| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.2 SB_23276| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.2 SB_11067| Best HMM Match : RVT_1 (HMM E-Value=0) 28 9.2 >SB_51931| Best HMM Match : Ribosomal_L3 (HMM E-Value=0) Length = 338 Score = 244 bits (596), Expect = 8e-65 Identities = 115/154 (74%), Positives = 125/154 (81%), Gaps = 1/154 (0%) Frame = -2 Query: 747 HTQMKLLKQRXKKAHIMEIQLNGGT-IEDKVKWAREHLEKPIPVDSVFAQDEMIDCIXXX 571 HTQ KLLK R KKAHIMEIQ+NGG + +KV W RE LE P PV VF+ DEMID I Sbjct: 164 HTQQKLLKMRQKKAHIMEIQVNGGKDVAEKVDWCRERLENPAPVRKVFSPDEMIDVIGVT 223 Query: 570 XXXXXXXXTSRWHTKKLPRKTHKGLRKVACIGAWHPSRVSFTVARAGQKGYHHRTEMNKK 391 T RW TKKLPRKTHKGLRKVACIGAWHP+RVSF+VARAGQ GYHHRTE+NKK Sbjct: 224 KGHGFKGVTYRWGTKKLPRKTHKGLRKVACIGAWHPARVSFSVARAGQAGYHHRTELNKK 283 Query: 390 IYRIGQGIHKKDGKVIKNNASTEYDLSEKSITPM 289 IYRIGQGIHKKDGKVIKNNASTEYDL++KSI+PM Sbjct: 284 IYRIGQGIHKKDGKVIKNNASTEYDLTDKSISPM 317 >SB_14332| Best HMM Match : Ribosomal_L3 (HMM E-Value=8.6e-34) Length = 347 Score = 140 bits (338), Expect = 1e-33 Identities = 62/82 (75%), Positives = 70/82 (85%) Frame = -2 Query: 288 GGFPHYGEVNNDFVMIKGCCMGPKKRIITLRKSLRVHTKRAALEKINLKFIDTSSKFGHG 109 GGFPHYG+VN DF+M+KGC +GPKKR++TLRKSL VHT R A EKI LKFIDTSSKFGHG Sbjct: 215 GGFPHYGQVNEDFLMVKGCVVGPKKRVLTLRKSLLVHTSRDAAEKITLKFIDTSSKFGHG 274 Query: 108 RFQTPADKAAFMGTLKKDRIRE 43 RFQ PA+K AFMG LK DR +E Sbjct: 275 RFQHPAEKRAFMGMLKSDREKE 296 >SB_7140| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 97.1 bits (231), Expect = 1e-20 Identities = 42/45 (93%), Positives = 45/45 (100%) Frame = -2 Query: 423 GYHHRTEMNKKIYRIGQGIHKKDGKVIKNNASTEYDLSEKSITPM 289 GYHHRTE+NKKIYRIGQGIHKKDGKVIKNNASTEYDL++KSITPM Sbjct: 2 GYHHRTELNKKIYRIGQGIHKKDGKVIKNNASTEYDLTDKSITPM 46 >SB_22251| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 497 Score = 29.9 bits (64), Expect = 2.3 Identities = 16/35 (45%), Positives = 21/35 (60%), Gaps = 1/35 (2%) Frame = -3 Query: 380 LDKESTKRMAKLLKTMHLLSMTCLRNP-LHRWEVS 279 LDK MA + HLLS+T RNP LH +E++ Sbjct: 247 LDKRFQDEMAFNVSKCHLLSVTNKRNPSLHEYEIN 281 >SB_51282| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 217 Score = 29.5 bits (63), Expect = 3.0 Identities = 14/42 (33%), Positives = 21/42 (50%) Frame = -2 Query: 363 KKDGKVIKNNASTEYDLSEKSITPMGGFPHYGEVNNDFVMIK 238 KK V +N+ T D + + GFPHY + +D + IK Sbjct: 44 KKCWTVTQNDVPTPLDCGLSAWRILSGFPHYKLIEDDHIEIK 85 >SB_6540| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 366 Score = 28.7 bits (61), Expect = 5.3 Identities = 14/50 (28%), Positives = 24/50 (48%) Frame = -2 Query: 219 KKRIITLRKSLRVHTKRAALEKINLKFIDTSSKFGHGRFQTPADKAAFMG 70 K R++ +K ++H+ + K ++F+ SKF H T A A G Sbjct: 317 KDRLLEWKKERQIHSFSSTTLKARIRFVAAMSKFAHTTEDTTAWDEATKG 366 >SB_35285| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 561 Score = 28.3 bits (60), Expect = 7.0 Identities = 14/54 (25%), Positives = 27/54 (50%) Frame = +1 Query: 271 IMGETSHRCNGFLRQVILSRCIVFNNFAILFVDSLSNTIDFLVHFSTVMITFLT 432 ++GE FLR++ +S C++ N+ F + D L+ F++ + F T Sbjct: 274 VLGENFQDLARFLRELQISPCLMVLNYPSFFSADIQKLNDALMFFTSRPLLFET 327 >SB_22404| Best HMM Match : SNF2_N (HMM E-Value=0) Length = 1918 Score = 28.3 bits (60), Expect = 7.0 Identities = 17/43 (39%), Positives = 19/43 (44%), Gaps = 1/43 (2%) Frame = -1 Query: 748 PHSNEAVKTATKEGSHYGNPT*RWYHRGQSEMGQ-RTSGETYP 623 PH N + T G H NPT HR S GQ R +G P Sbjct: 282 PHQNGSNVTNIPVGGHPSNPTPAAIHRSMSVGGQPRVNGPGNP 324 >SB_11005| Best HMM Match : SspH (HMM E-Value=0.85) Length = 105 Score = 28.3 bits (60), Expect = 7.0 Identities = 12/32 (37%), Positives = 19/32 (59%) Frame = -2 Query: 726 KQRXKKAHIMEIQLNGGTIEDKVKWAREHLEK 631 KQ+ K + E++ N +EDKV+W + EK Sbjct: 53 KQKLAKNLLREMERNETDVEDKVEWTKAITEK 84 >SB_5912| Best HMM Match : 7tm_1 (HMM E-Value=7.3e-08) Length = 337 Score = 28.3 bits (60), Expect = 7.0 Identities = 20/55 (36%), Positives = 28/55 (50%) Frame = +1 Query: 280 ETSHRCNGFLRQVILSRCIVFNNFAILFVDSLSNTIDFLVHFSTVMITFLTSTSY 444 ETS R FLRQV ++ C + FA++ + T + LV FS L+ SY Sbjct: 9 ETSLRYVSFLRQVYIANCALNAIFAVIAI-----TGNLLVLFSIWKCRLLSEPSY 58 >SB_57037| Best HMM Match : RVT_1 (HMM E-Value=3.4e-15) Length = 291 Score = 27.9 bits (59), Expect = 9.2 Identities = 15/34 (44%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Frame = -3 Query: 377 DKESTKRMAKLLKTMHLLSMTCLRNP-LHRWEVS 279 D T +MA + HLLS+T RNP LH +E++ Sbjct: 173 DWSDTWQMAFNVSKCHLLSVTNKRNPSLHEYEIN 206 >SB_56220| Best HMM Match : RVT_1 (HMM E-Value=3.7e-16) Length = 453 Score = 27.9 bits (59), Expect = 9.2 Identities = 15/34 (44%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Frame = -3 Query: 377 DKESTKRMAKLLKTMHLLSMTCLRNP-LHRWEVS 279 D T +MA + HLLS+T RNP LH +E++ Sbjct: 204 DWSDTWQMAFNVSKCHLLSVTNKRNPSLHEYEIN 237 >SB_37487| Best HMM Match : RVT_1 (HMM E-Value=0.03) Length = 347 Score = 27.9 bits (59), Expect = 9.2 Identities = 15/34 (44%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Frame = -3 Query: 377 DKESTKRMAKLLKTMHLLSMTCLRNP-LHRWEVS 279 D T +MA + HLLS+T RNP LH +E++ Sbjct: 275 DWSDTWQMAFNVSKCHLLSVTNKRNPSLHEYEIN 308 >SB_33284| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 263 Score = 27.9 bits (59), Expect = 9.2 Identities = 15/34 (44%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Frame = -3 Query: 377 DKESTKRMAKLLKTMHLLSMTCLRNP-LHRWEVS 279 D T +MA + HLLS+T RNP LH +E++ Sbjct: 59 DWSDTWQMAFNVSKCHLLSVTNKRNPSLHEYEIN 92 >SB_30332| Best HMM Match : RVT_1 (HMM E-Value=2.7e-34) Length = 1683 Score = 27.9 bits (59), Expect = 9.2 Identities = 15/34 (44%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Frame = -3 Query: 377 DKESTKRMAKLLKTMHLLSMTCLRNP-LHRWEVS 279 D T +MA + HLLS+T RNP LH +E++ Sbjct: 1091 DWSDTWQMAFNVSKCHLLSVTNKRNPSLHEYEIN 1124 Score = 27.9 bits (59), Expect = 9.2 Identities = 15/34 (44%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Frame = -3 Query: 377 DKESTKRMAKLLKTMHLLSMTCLRNP-LHRWEVS 279 D T +MA + HLLS+T RNP LH +E++ Sbjct: 1283 DWSDTWQMAFNVSKCHLLSVTNKRNPSLHEYEIN 1316 >SB_28979| Best HMM Match : RVT_1 (HMM E-Value=1.6e-40) Length = 892 Score = 27.9 bits (59), Expect = 9.2 Identities = 15/34 (44%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Frame = -3 Query: 377 DKESTKRMAKLLKTMHLLSMTCLRNP-LHRWEVS 279 D T +MA + HLLS+T RNP LH +E++ Sbjct: 643 DWSDTWQMAFNVSKCHLLSVTNKRNPSLHEYEIN 676 >SB_26992| Best HMM Match : rve (HMM E-Value=6.3e-36) Length = 1022 Score = 27.9 bits (59), Expect = 9.2 Identities = 15/34 (44%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Frame = -3 Query: 377 DKESTKRMAKLLKTMHLLSMTCLRNP-LHRWEVS 279 D T +MA + HLLS+T RNP LH +E++ Sbjct: 832 DWSDTWQMAFNVSKCHLLSVTNKRNPSLHEYEIN 865 >SB_26886| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 6489 Score = 27.9 bits (59), Expect = 9.2 Identities = 11/36 (30%), Positives = 20/36 (55%) Frame = -2 Query: 336 NASTEYDLSEKSITPMGGFPHYGEVNNDFVMIKGCC 229 ++STE++ + + G F +G+V ND + CC Sbjct: 3492 HSSTEFNSTLRGGIKSGKFKDFGKVRNDVDCVNRCC 3527 >SB_51232| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1676 Score = 27.9 bits (59), Expect = 9.2 Identities = 15/34 (44%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Frame = -3 Query: 377 DKESTKRMAKLLKTMHLLSMTCLRNP-LHRWEVS 279 D T +MA + HLLS+T RNP LH +E++ Sbjct: 895 DWSDTWQMAFNVSKCHLLSVTNKRNPSLHEYEIN 928 >SB_23276| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 27.9 bits (59), Expect = 9.2 Identities = 15/34 (44%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Frame = -3 Query: 377 DKESTKRMAKLLKTMHLLSMTCLRNP-LHRWEVS 279 D T +MA + HLLS+T RNP LH +E++ Sbjct: 75 DWSDTWQMAFNVSKCHLLSVTNKRNPSLHEYEIN 108 >SB_11067| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 1176 Score = 27.9 bits (59), Expect = 9.2 Identities = 15/34 (44%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Frame = -3 Query: 377 DKESTKRMAKLLKTMHLLSMTCLRNP-LHRWEVS 279 D T +MA + HLLS+T RNP LH +E++ Sbjct: 979 DWSDTWQMAFNVSKCHLLSVTNKRNPSLHEYEIN 1012 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 24,594,647 Number of Sequences: 59808 Number of extensions: 536577 Number of successful extensions: 1170 Number of sequences better than 10.0: 21 Number of HSP's better than 10.0 without gapping: 1106 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1168 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 2022185256 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -