BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV12l03r (489 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g18180.1 68418.m02134 Gar1 RNA-binding region family protein ... 28 2.9 At5g41520.1 68418.m05044 40S ribosomal protein S10 (RPS10B) cont... 28 3.9 At4g14280.1 68417.m02201 hypothetical protein 27 6.8 At1g73810.1 68414.m08546 expressed protein contains Pfam profile... 27 9.0 >At5g18180.1 68418.m02134 Gar1 RNA-binding region family protein contains Pfam profile PF04410: Gar1 protein RNA binding region Length = 189 Score = 28.3 bits (60), Expect = 2.9 Identities = 16/34 (47%), Positives = 18/34 (52%), Gaps = 3/34 (8%) Frame = -3 Query: 223 QGRPSPGSRG---VPVRDRPPCRGRGRFNFRHSP 131 Q + G RG VP R R P RGRG F R +P Sbjct: 133 QPKGQSGGRGEGRVPPRGRGPPRGRGNFRGRGAP 166 >At5g41520.1 68418.m05044 40S ribosomal protein S10 (RPS10B) contains similarity to 40S ribosomal protein S10 Length = 180 Score = 27.9 bits (59), Expect = 3.9 Identities = 17/46 (36%), Positives = 20/46 (43%), Gaps = 3/46 (6%) Frame = +1 Query: 157 PAPDKADGRELGHPYFPGSD---GPDASTGRRRVPHVDSLRAGCRS 285 PA K + LG P+ G D GP G RR D R G +S Sbjct: 89 PATLKKQQKPLGRPFGGGGDRPRGPPRGDGERRFGDRDGYRGGPKS 134 >At4g14280.1 68417.m02201 hypothetical protein Length = 798 Score = 27.1 bits (57), Expect = 6.8 Identities = 18/43 (41%), Positives = 22/43 (51%) Frame = +2 Query: 194 TPTSRARTALTRLPAGAVYLTLTACELAVAARVTTKLRNSLSF 322 TP R T L +PA LTL A LAV ++ + L SL F Sbjct: 27 TPEPRRPTQLPPVPAPEKKLTLFALRLAVLEKIASGL-GSLGF 68 >At1g73810.1 68414.m08546 expressed protein contains Pfam profile PF03267: Arabidopsis protein of unknown function, DUF266 Length = 418 Score = 26.6 bits (56), Expect = 9.0 Identities = 13/22 (59%), Positives = 14/22 (63%) Frame = -3 Query: 193 VPVRDRPPCRGRGRFNFRHSPV 128 V V D P GRGR+N R SPV Sbjct: 262 VDVYDLPGPAGRGRYNRRMSPV 283 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,318,922 Number of Sequences: 28952 Number of extensions: 169323 Number of successful extensions: 340 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 334 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 340 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 848837888 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -