BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV12k20f (618 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY268030-1|AAP23055.1| 602|Apis mellifera dorsal protein protein. 23 1.8 AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. 23 2.4 AY569720-1|AAS86673.1| 406|Apis mellifera complementary sex det... 23 3.2 AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex det... 23 3.2 AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex det... 23 3.2 AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex det... 23 3.2 AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex det... 23 3.2 AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex det... 23 3.2 AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex det... 23 3.2 AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex det... 23 3.2 AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex det... 23 3.2 AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex det... 23 3.2 EF625898-1|ABR45905.1| 686|Apis mellifera hexamerin protein. 22 4.2 EF589162-1|ABQ84439.1| 686|Apis mellifera hexamerin 70c protein. 22 4.2 AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. 22 4.2 AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. 22 4.2 AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. 22 4.2 AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. 22 4.2 AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex det... 22 4.2 X52884-1|CAA37066.1| 461|Apis mellifera elongation factor 1 alp... 21 7.3 EF013389-1|ABK54743.1| 172|Apis mellifera elongation factor 1-a... 21 7.3 DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. 21 7.3 AY208278-1|AAO48970.1| 274|Apis mellifera elongation factor 1-a... 21 7.3 AF134816-1|AAD40232.1| 50|Apis mellifera unknown protein. 21 7.3 AF015267-1|AAC38959.1| 461|Apis mellifera elongation factor-1al... 21 7.3 DQ667192-1|ABG75744.1| 489|Apis mellifera pH-sensitive chloride... 21 9.6 DQ667191-1|ABG75743.1| 475|Apis mellifera pH-sensitive chloride... 21 9.6 DQ667190-1|ABG75742.1| 509|Apis mellifera pH-sensitive chloride... 21 9.6 DQ667189-1|ABG75741.1| 458|Apis mellifera pH-sensitive chloride... 21 9.6 AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. 21 9.6 >AY268030-1|AAP23055.1| 602|Apis mellifera dorsal protein protein. Length = 602 Score = 23.4 bits (48), Expect = 1.8 Identities = 13/47 (27%), Positives = 29/47 (61%) Frame = +1 Query: 235 EDFHALAAFAEDIKSTGLSNIVIITNNFSILSARLNLVLSLPRVEAS 375 E+F +L ++++T ++NI+ + N + NL LSLP+++++ Sbjct: 489 EEFQSLNNAVGEMEATNVTNILSMDNT------QYNLDLSLPQLDST 529 >AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 23.0 bits (47), Expect = 2.4 Identities = 20/55 (36%), Positives = 27/55 (49%) Frame = +3 Query: 15 SRHGRHEDFRCSHRNSGLCQYTNF**TDGDKRTSRALGH*PGCFRHRKYQKANKR 179 S H R+ED R RNS Y N DG++ SR R R+Y+K ++R Sbjct: 229 SCHSRYEDLRHEDRNS----YRN----DGERSCSRD--------RSREYKKKDRR 267 >AY569720-1|AAS86673.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 22.6 bits (46), Expect = 3.2 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = -3 Query: 421 SLRNRTH*AQHGQHR 377 SLRNRTH QH R Sbjct: 216 SLRNRTHDFQHTSSR 230 >AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 22.6 bits (46), Expect = 3.2 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = -3 Query: 421 SLRNRTH*AQHGQHR 377 SLRNRTH QH R Sbjct: 205 SLRNRTHGFQHTSSR 219 >AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 22.6 bits (46), Expect = 3.2 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = -3 Query: 421 SLRNRTH*AQHGQHR 377 SLRNRTH QH R Sbjct: 216 SLRNRTHGFQHTSSR 230 >AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 22.6 bits (46), Expect = 3.2 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = -3 Query: 421 SLRNRTH*AQHGQHR 377 SLRNRTH QH R Sbjct: 216 SLRNRTHGFQHTSSR 230 >AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 22.6 bits (46), Expect = 3.2 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = -3 Query: 421 SLRNRTH*AQHGQHR 377 SLRNRTH QH R Sbjct: 205 SLRNRTHGFQHTSSR 219 >AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex determiner protein. Length = 413 Score = 22.6 bits (46), Expect = 3.2 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = -3 Query: 421 SLRNRTH*AQHGQHR 377 SLRNRTH QH R Sbjct: 216 SLRNRTHGFQHTSSR 230 >AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 22.6 bits (46), Expect = 3.2 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = -3 Query: 421 SLRNRTH*AQHGQHR 377 SLRNRTH QH R Sbjct: 205 SLRNRTHGFQHTSSR 219 >AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex determiner protein. Length = 418 Score = 22.6 bits (46), Expect = 3.2 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = -3 Query: 421 SLRNRTH*AQHGQHR 377 SLRNRTH QH R Sbjct: 221 SLRNRTHGFQHTSSR 235 >AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex determiner protein. Length = 385 Score = 22.6 bits (46), Expect = 3.2 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = -3 Query: 421 SLRNRTH*AQHGQHR 377 SLRNRTH QH R Sbjct: 216 SLRNRTHGFQHTSSR 230 >AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex determiner protein. Length = 410 Score = 22.6 bits (46), Expect = 3.2 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = -3 Query: 421 SLRNRTH*AQHGQHR 377 SLRNRTH QH R Sbjct: 216 SLRNRTHGFQHTSSR 230 >EF625898-1|ABR45905.1| 686|Apis mellifera hexamerin protein. Length = 686 Score = 22.2 bits (45), Expect = 4.2 Identities = 8/20 (40%), Positives = 14/20 (70%) Frame = -3 Query: 124 SALDVRLSPSVHQKFVYWHK 65 S +D+ +V QKF++W+K Sbjct: 67 SNMDMYKDKNVVQKFLWWYK 86 >EF589162-1|ABQ84439.1| 686|Apis mellifera hexamerin 70c protein. Length = 686 Score = 22.2 bits (45), Expect = 4.2 Identities = 8/20 (40%), Positives = 14/20 (70%) Frame = -3 Query: 124 SALDVRLSPSVHQKFVYWHK 65 S +D+ +V QKF++W+K Sbjct: 67 SNMDMYKDKNVVQKFLWWYK 86 >AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.2 bits (45), Expect = 4.2 Identities = 20/55 (36%), Positives = 27/55 (49%) Frame = +3 Query: 15 SRHGRHEDFRCSHRNSGLCQYTNF**TDGDKRTSRALGH*PGCFRHRKYQKANKR 179 S H R+ED R RNS Y N DG++ SR R R+Y+K ++R Sbjct: 229 SCHSRYEDSRHEDRNS----YRN----DGERSCSRD--------RSREYKKKDRR 267 >AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.2 bits (45), Expect = 4.2 Identities = 20/55 (36%), Positives = 27/55 (49%) Frame = +3 Query: 15 SRHGRHEDFRCSHRNSGLCQYTNF**TDGDKRTSRALGH*PGCFRHRKYQKANKR 179 S H R+ED R RNS Y N DG++ SR R R+Y+K ++R Sbjct: 229 SCHSRYEDSRHEDRNS----YRN----DGERSCSRD--------RSREYKKKDRR 267 >AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.2 bits (45), Expect = 4.2 Identities = 20/55 (36%), Positives = 27/55 (49%) Frame = +3 Query: 15 SRHGRHEDFRCSHRNSGLCQYTNF**TDGDKRTSRALGH*PGCFRHRKYQKANKR 179 S H R+ED R RNS Y N DG++ SR R R+Y+K ++R Sbjct: 229 SCHSRYEDSRHEDRNS----YRN----DGERSCSRD--------RSREYKKKDRR 267 >AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.2 bits (45), Expect = 4.2 Identities = 20/55 (36%), Positives = 27/55 (49%) Frame = +3 Query: 15 SRHGRHEDFRCSHRNSGLCQYTNF**TDGDKRTSRALGH*PGCFRHRKYQKANKR 179 S H R+ED R RNS Y N DG++ SR R R+Y+K ++R Sbjct: 229 SCHSRYEDSRHEDRNS----YRN----DGERSCSRD--------RSREYKKKDRR 267 >AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex determiner protein. Length = 401 Score = 22.2 bits (45), Expect = 4.2 Identities = 20/55 (36%), Positives = 27/55 (49%) Frame = +3 Query: 15 SRHGRHEDFRCSHRNSGLCQYTNF**TDGDKRTSRALGH*PGCFRHRKYQKANKR 179 S H R+ED R RNS Y N DG++ SR R R+Y+K ++R Sbjct: 229 SCHSRYEDSRHEDRNS----YRN----DGERSCSRD--------RSREYKKKDRR 267 >X52884-1|CAA37066.1| 461|Apis mellifera elongation factor 1 alpha protein. Length = 461 Score = 21.4 bits (43), Expect = 7.3 Identities = 9/13 (69%), Positives = 11/13 (84%) Frame = -1 Query: 99 RLFIKSLCTGTSQ 61 R FIK++ TGTSQ Sbjct: 96 RDFIKNMITGTSQ 108 >EF013389-1|ABK54743.1| 172|Apis mellifera elongation factor 1-alpha protein. Length = 172 Score = 21.4 bits (43), Expect = 7.3 Identities = 9/13 (69%), Positives = 11/13 (84%) Frame = -1 Query: 99 RLFIKSLCTGTSQ 61 R FIK++ TGTSQ Sbjct: 23 RDFIKNMITGTSQ 35 >DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. Length = 828 Score = 21.4 bits (43), Expect = 7.3 Identities = 6/9 (66%), Positives = 7/9 (77%) Frame = +3 Query: 432 QWTCRHKQP 458 QWTCR +P Sbjct: 486 QWTCRQPEP 494 >AY208278-1|AAO48970.1| 274|Apis mellifera elongation factor 1-alpha protein. Length = 274 Score = 21.4 bits (43), Expect = 7.3 Identities = 9/13 (69%), Positives = 11/13 (84%) Frame = -1 Query: 99 RLFIKSLCTGTSQ 61 R FIK++ TGTSQ Sbjct: 39 RDFIKNMITGTSQ 51 >AF134816-1|AAD40232.1| 50|Apis mellifera unknown protein. Length = 50 Score = 21.4 bits (43), Expect = 7.3 Identities = 7/17 (41%), Positives = 9/17 (52%) Frame = -3 Query: 121 ALDVRLSPSVHQKFVYW 71 ALD + P H +YW Sbjct: 24 ALDCSIKPKDHNGSIYW 40 >AF015267-1|AAC38959.1| 461|Apis mellifera elongation factor-1alpha F2 protein. Length = 461 Score = 21.4 bits (43), Expect = 7.3 Identities = 9/13 (69%), Positives = 11/13 (84%) Frame = -1 Query: 99 RLFIKSLCTGTSQ 61 R FIK++ TGTSQ Sbjct: 96 RDFIKNMITGTSQ 108 >DQ667192-1|ABG75744.1| 489|Apis mellifera pH-sensitive chloride channel variant 4 protein. Length = 489 Score = 21.0 bits (42), Expect = 9.6 Identities = 14/35 (40%), Positives = 19/35 (54%) Frame = -2 Query: 230 GGMTISLLSTSSGSNPASLICFLIFSMAEATWLVT 126 GG S+LS S S +SLI ++ + A LVT Sbjct: 13 GGRLSSVLSLSLTSLASSLIFTILCILTLALTLVT 47 >DQ667191-1|ABG75743.1| 475|Apis mellifera pH-sensitive chloride channel variant 3 protein. Length = 475 Score = 21.0 bits (42), Expect = 9.6 Identities = 14/35 (40%), Positives = 19/35 (54%) Frame = -2 Query: 230 GGMTISLLSTSSGSNPASLICFLIFSMAEATWLVT 126 GG S+LS S S +SLI ++ + A LVT Sbjct: 13 GGRLSSVLSLSLTSLASSLIFTILCILTLALTLVT 47 >DQ667190-1|ABG75742.1| 509|Apis mellifera pH-sensitive chloride channel variant 1 protein. Length = 509 Score = 21.0 bits (42), Expect = 9.6 Identities = 14/35 (40%), Positives = 19/35 (54%) Frame = -2 Query: 230 GGMTISLLSTSSGSNPASLICFLIFSMAEATWLVT 126 GG S+LS S S +SLI ++ + A LVT Sbjct: 13 GGRLSSVLSLSLTSLASSLIFTILCILTLALTLVT 47 >DQ667189-1|ABG75741.1| 458|Apis mellifera pH-sensitive chloride channel protein. Length = 458 Score = 21.0 bits (42), Expect = 9.6 Identities = 14/35 (40%), Positives = 19/35 (54%) Frame = -2 Query: 230 GGMTISLLSTSSGSNPASLICFLIFSMAEATWLVT 126 GG S+LS S S +SLI ++ + A LVT Sbjct: 13 GGRLSSVLSLSLTSLASSLIFTILCILTLALTLVT 47 >AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. Length = 400 Score = 21.0 bits (42), Expect = 9.6 Identities = 15/35 (42%), Positives = 18/35 (51%) Frame = +3 Query: 15 SRHGRHEDFRCSHRNSGLCQYTNF**TDGDKRTSR 119 S H R+ED R RNS Y N DG++ SR Sbjct: 229 SCHSRYEDSRHEDRNS----YRN----DGERSCSR 255 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 155,037 Number of Sequences: 438 Number of extensions: 3239 Number of successful extensions: 42 Number of sequences better than 10.0: 30 Number of HSP's better than 10.0 without gapping: 42 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 42 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 18337950 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -