BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV12k19r (730 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292357-1|CAL23169.2| 355|Tribolium castaneum gustatory recept... 23 3.3 AM292364-1|CAL23176.2| 353|Tribolium castaneum gustatory recept... 22 4.4 AM292360-1|CAL23172.2| 427|Tribolium castaneum gustatory recept... 21 7.7 AM292331-1|CAL23143.2| 437|Tribolium castaneum gustatory recept... 21 7.7 >AM292357-1|CAL23169.2| 355|Tribolium castaneum gustatory receptor candidate 36 protein. Length = 355 Score = 22.6 bits (46), Expect = 3.3 Identities = 10/39 (25%), Positives = 23/39 (58%) Frame = -2 Query: 549 VRAGSIIVLQKDVTLTAVDTRLRSQYSLTIALKCSNETL 433 ++A + ++L T+ + TR++S LTI + + +T+ Sbjct: 42 IQAWTYLILLTTWTVISASTRIKSFKFLTIGVGITTDTI 80 >AM292364-1|CAL23176.2| 353|Tribolium castaneum gustatory receptor candidate 43 protein. Length = 353 Score = 22.2 bits (45), Expect = 4.4 Identities = 11/35 (31%), Positives = 19/35 (54%), Gaps = 3/35 (8%) Frame = -2 Query: 186 SLTIQAEGEDFDILCKPSGALWANVIR---EIILY 91 S+ +Q E FD LC+ + + N I +++LY Sbjct: 134 SICVQTEKSVFDFLCRHTVEYFQNYIHFFYQLLLY 168 >AM292360-1|CAL23172.2| 427|Tribolium castaneum gustatory receptor candidate 39 protein. Length = 427 Score = 21.4 bits (43), Expect = 7.7 Identities = 8/24 (33%), Positives = 11/24 (45%) Frame = +1 Query: 145 KNIKIFSFCLYCKALVIGLKNHGH 216 K +F YC L+ + N GH Sbjct: 311 KEAGLFMIAFYCMTLLYIICNEGH 334 >AM292331-1|CAL23143.2| 437|Tribolium castaneum gustatory receptor candidate 10 protein. Length = 437 Score = 21.4 bits (43), Expect = 7.7 Identities = 8/24 (33%), Positives = 11/24 (45%) Frame = +1 Query: 145 KNIKIFSFCLYCKALVIGLKNHGH 216 K +F YC L+ + N GH Sbjct: 311 KEAGLFMIAFYCMTLLYIICNEGH 334 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 124,740 Number of Sequences: 336 Number of extensions: 2041 Number of successful extensions: 6 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19467635 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -