BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV12k19r (730 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value M93691-1|AAA29366.1| 574|Anopheles gambiae protein ( Anopheles ... 25 1.8 AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. 24 5.5 AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. 24 5.5 AJ821850-1|CAH25390.1| 426|Anopheles gambiae alpha-2,6-sialyltr... 24 5.5 >M93691-1|AAA29366.1| 574|Anopheles gambiae protein ( Anopheles gambiae RT2 retroposon. ). Length = 574 Score = 25.4 bits (53), Expect = 1.8 Identities = 12/34 (35%), Positives = 21/34 (61%) Frame = +2 Query: 125 NAPLGLQRISKSSPSACIVRLLSSALKIMVIDSD 226 NAPL L+ + K A + RL++ +++V+D D Sbjct: 399 NAPLMLEGVRKIIGDAGVSRLVTEMGELLVVDID 432 >AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. Length = 3320 Score = 23.8 bits (49), Expect = 5.5 Identities = 9/19 (47%), Positives = 14/19 (73%) Frame = +3 Query: 39 RSLFV*NYQNYSNLHLNHI 95 RSLF+ ++ Y+ LHL H+ Sbjct: 929 RSLFLDGFKMYARLHLLHL 947 >AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. Length = 3318 Score = 23.8 bits (49), Expect = 5.5 Identities = 9/19 (47%), Positives = 14/19 (73%) Frame = +3 Query: 39 RSLFV*NYQNYSNLHLNHI 95 RSLF+ ++ Y+ LHL H+ Sbjct: 930 RSLFLDGFKMYARLHLLHL 948 >AJ821850-1|CAH25390.1| 426|Anopheles gambiae alpha-2,6-sialyltransferase protein. Length = 426 Score = 23.8 bits (49), Expect = 5.5 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = -2 Query: 78 DLNNFDNFKQIRTS 37 D N FDNFK+ R+S Sbjct: 294 DFNLFDNFKKFRSS 307 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 548,524 Number of Sequences: 2352 Number of extensions: 8101 Number of successful extensions: 12 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 74428737 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -