BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV12k19f (601 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_45780| Best HMM Match : Trefoil (HMM E-Value=0.0002) 33 0.13 SB_17664| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.8 SB_943| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.8 >SB_45780| Best HMM Match : Trefoil (HMM E-Value=0.0002) Length = 53 Score = 33.5 bits (73), Expect = 0.13 Identities = 18/51 (35%), Positives = 23/51 (45%), Gaps = 2/51 (3%) Frame = +1 Query: 364 CLVARTLRLPCGYANVNSEQCHP-HCCYDFRSKTCF-HRFPSRFSYVMDRV 510 C V R PCGY + + C CCYD TCF HR + +R+ Sbjct: 3 CSVKIADREPCGYDGIPVDACRDLDCCYDKGLGTCFNHRKALHIEHTENRL 53 >SB_17664| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 374 Score = 27.5 bits (58), Expect = 8.8 Identities = 18/54 (33%), Positives = 25/54 (46%) Frame = -1 Query: 274 LPTKLISL*LVCLAKFYRTI*SV*FSRIQIHNHLLESRSKVLVRAVSYFMFVFC 113 L +IS+ LV + K RT ++ Q L RS V + S +FVFC Sbjct: 204 LVISIISINLVIIRKLVRTQVAMNLPEAQREKRLRSFRSAVRMVLCSLLLFVFC 257 >SB_943| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 628 Score = 27.5 bits (58), Expect = 8.8 Identities = 9/19 (47%), Positives = 15/19 (78%) Frame = -2 Query: 180 IIFLSLVQRFWCVRYHISC 124 I+FL+L+ + C +YH+SC Sbjct: 23 ILFLTLLLKLPCSKYHVSC 41 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,280,784 Number of Sequences: 59808 Number of extensions: 333994 Number of successful extensions: 652 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 623 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 652 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1451595000 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -