BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV12k19f (601 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 26 0.25 DQ667182-1|ABG75734.1| 445|Apis mellifera GABA-gated chloride c... 23 2.3 DQ667181-1|ABG75733.1| 445|Apis mellifera GABA-gated chloride c... 23 2.3 AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex det... 23 2.3 DQ325133-1|ABD14147.1| 181|Apis mellifera complementary sex det... 23 3.0 DQ325075-1|ABD14089.1| 181|Apis mellifera complementary sex det... 23 3.0 DQ325074-1|ABD14088.1| 181|Apis mellifera complementary sex det... 23 3.0 DQ325073-1|ABD14087.1| 181|Apis mellifera complementary sex det... 23 3.0 DQ325072-1|ABD14086.1| 181|Apis mellifera complementary sex det... 23 3.0 DQ325071-1|ABD14085.1| 181|Apis mellifera complementary sex det... 23 3.0 DQ325070-1|ABD14084.1| 181|Apis mellifera complementary sex det... 23 3.0 DQ325069-1|ABD14083.1| 181|Apis mellifera complementary sex det... 23 3.0 DQ325068-1|ABD14082.1| 181|Apis mellifera complementary sex det... 23 3.0 AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex det... 23 3.0 AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex det... 23 3.0 DQ325076-1|ABD14090.1| 191|Apis mellifera complementary sex det... 22 4.0 DQ325090-1|ABD14104.1| 178|Apis mellifera complementary sex det... 21 9.2 DQ325077-1|ABD14091.1| 181|Apis mellifera complementary sex det... 21 9.2 AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamat... 21 9.2 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 26.2 bits (55), Expect = 0.25 Identities = 18/61 (29%), Positives = 25/61 (40%) Frame = +1 Query: 346 GFSFGSCLVARTLRLPCGYANVNSEQCHPHCCYDFRSKTCFHRFPSRFSYVMDRVWDEDV 525 G + S AR+ + C Y CH CC DF + C P+ DR W+ + Sbjct: 721 GVAIVSASTARSEQFLCRYEAHCFALCH--CC-DFDACDCEMTCPAGCKCYNDRTWNTNA 777 Query: 526 V 528 V Sbjct: 778 V 778 Score = 24.2 bits (50), Expect = 0.99 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +1 Query: 13 FALQEIRDFIVCDCEM 60 FAL DF CDCEM Sbjct: 744 FALCHCCDFDACDCEM 759 >DQ667182-1|ABG75734.1| 445|Apis mellifera GABA-gated chloride channel protein. Length = 445 Score = 23.0 bits (47), Expect = 2.3 Identities = 9/33 (27%), Positives = 16/33 (48%) Frame = -2 Query: 225 IVPSDLFSFLVFKFIIIFLSLVQRFWCVRYHIS 127 + PSD+ + F + F+ +W + HIS Sbjct: 399 MTPSDIDKYSRIVFPVCFVCFNLMYWIIYLHIS 431 >DQ667181-1|ABG75733.1| 445|Apis mellifera GABA-gated chloride channel protein. Length = 445 Score = 23.0 bits (47), Expect = 2.3 Identities = 9/33 (27%), Positives = 16/33 (48%) Frame = -2 Query: 225 IVPSDLFSFLVFKFIIIFLSLVQRFWCVRYHIS 127 + PSD+ + F + F+ +W + HIS Sbjct: 399 MTPSDIDKYSRIVFPVCFVCFNLMYWIIYLHIS 431 >AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex determiner protein. Length = 426 Score = 23.0 bits (47), Expect = 2.3 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -3 Query: 107 YRNYNHTN*IKYYFNIIS 54 Y N N+ N K Y+NII+ Sbjct: 341 YNNNNYNNYKKLYYNIIN 358 >DQ325133-1|ABD14147.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 22.6 bits (46), Expect = 3.0 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = -3 Query: 107 YRNYNHTN*IKYYFNI 60 Y NYN N K Y+NI Sbjct: 98 YNNYNKHNYNKLYYNI 113 >DQ325075-1|ABD14089.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 22.6 bits (46), Expect = 3.0 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = -3 Query: 107 YRNYNHTN*IKYYFNI 60 Y NYN N K Y+NI Sbjct: 98 YNNYNKHNYNKLYYNI 113 >DQ325074-1|ABD14088.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 22.6 bits (46), Expect = 3.0 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = -3 Query: 107 YRNYNHTN*IKYYFNI 60 Y NYN N K Y+NI Sbjct: 98 YNNYNKHNYNKLYYNI 113 >DQ325073-1|ABD14087.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 22.6 bits (46), Expect = 3.0 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = -3 Query: 107 YRNYNHTN*IKYYFNI 60 Y NYN N K Y+NI Sbjct: 98 YNNYNKHNYNKLYYNI 113 >DQ325072-1|ABD14086.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 22.6 bits (46), Expect = 3.0 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = -3 Query: 107 YRNYNHTN*IKYYFNI 60 Y NYN N K Y+NI Sbjct: 98 YNNYNKHNYNKLYYNI 113 >DQ325071-1|ABD14085.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 22.6 bits (46), Expect = 3.0 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = -3 Query: 107 YRNYNHTN*IKYYFNI 60 Y NYN N K Y+NI Sbjct: 98 YNNYNKHNYNKLYYNI 113 >DQ325070-1|ABD14084.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 22.6 bits (46), Expect = 3.0 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = -3 Query: 107 YRNYNHTN*IKYYFNI 60 Y NYN N K Y+NI Sbjct: 98 YNNYNKHNYNKLYYNI 113 >DQ325069-1|ABD14083.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 22.6 bits (46), Expect = 3.0 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = -3 Query: 107 YRNYNHTN*IKYYFNI 60 Y NYN N K Y+NI Sbjct: 98 YNNYNKHNYNKLYYNI 113 >DQ325068-1|ABD14082.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 22.6 bits (46), Expect = 3.0 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = -3 Query: 107 YRNYNHTN*IKYYFNI 60 Y NYN N K Y+NI Sbjct: 98 YNNYNKHNYNKLYYNI 113 >AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 22.6 bits (46), Expect = 3.0 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = -3 Query: 107 YRNYNHTN*IKYYFNI 60 Y NYN N K Y+NI Sbjct: 331 YNNYNKHNYNKLYYNI 346 >AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 22.6 bits (46), Expect = 3.0 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = -3 Query: 107 YRNYNHTN*IKYYFNI 60 Y NYN N K Y+NI Sbjct: 331 YNNYNKHNYNKLYYNI 346 >DQ325076-1|ABD14090.1| 191|Apis mellifera complementary sex determiner protein. Length = 191 Score = 22.2 bits (45), Expect = 4.0 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = -3 Query: 113 FRYRNYNHTN*IKYYFNI 60 + Y N N+ N K Y+NI Sbjct: 104 YNYNNNNYNNYKKLYYNI 121 >DQ325090-1|ABD14104.1| 178|Apis mellifera complementary sex determiner protein. Length = 178 Score = 21.0 bits (42), Expect = 9.2 Identities = 9/17 (52%), Positives = 10/17 (58%) Frame = -3 Query: 107 YRNYNHTN*IKYYFNII 57 Y NYN+ N YY N I Sbjct: 94 YNNYNNYNKKLYYKNYI 110 >DQ325077-1|ABD14091.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.0 bits (42), Expect = 9.2 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = -3 Query: 107 YRNYNHTN*IKYYFNI 60 Y N N+ N K Y+NI Sbjct: 96 YNNNNYNNYKKLYYNI 111 >AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamate receptor protein. Length = 1040 Score = 21.0 bits (42), Expect = 9.2 Identities = 6/11 (54%), Positives = 7/11 (63%) Frame = -3 Query: 440 QQCGWHCSEFT 408 +QC WHC T Sbjct: 603 EQCCWHCFNCT 613 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 161,551 Number of Sequences: 438 Number of extensions: 3363 Number of successful extensions: 22 Number of sequences better than 10.0: 19 Number of HSP's better than 10.0 without gapping: 21 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 22 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 17604432 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -