BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV12k13r (710 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC577.09 |||ERCC-8 homolog |Schizosaccharomyces pombe|chr 2|||... 29 0.66 SPBC15D4.02 |||transcription factor, zf-fungal binuclear cluster... 27 3.5 SPAC15E1.10 ||SPAP7G5.01|PI31 proteasome regulator related|Schiz... 27 3.5 SPCC1494.07 |||conserved eukaryotic protein|Schizosaccharomyces ... 26 4.6 SPAC25B8.12c |||nucleotide-sugar phosphatase |Schizosaccharomyce... 26 4.6 SPBC14F5.02 |||sequence orphan|Schizosaccharomyces pombe|chr 2||... 26 6.1 SPBC17A3.02 |||conserved fungal protein|Schizosaccharomyces pomb... 25 8.1 SPCC23B6.04c |||sec14 cytosolic factor family|Schizosaccharomyce... 25 8.1 SPAC824.09c |||GTPase activating protein |Schizosaccharomyces po... 25 8.1 SPACUNK4.07c |cta4|sev4, SPAPYUK71.01|P-type ATPase, calcium tra... 25 8.1 >SPBC577.09 |||ERCC-8 homolog |Schizosaccharomyces pombe|chr 2|||Manual Length = 404 Score = 29.1 bits (62), Expect = 0.66 Identities = 15/53 (28%), Positives = 27/53 (50%), Gaps = 2/53 (3%) Frame = -3 Query: 570 AHCIIDDAVGVWRVRVG-STWGNSGGVVHH-VNRHIIHPNYGRWSRDNDIAIM 418 A C DD + VW + G +T G ++H+ +HP + S D+D+ ++ Sbjct: 262 ASCGTDDRIRVWNMESGRNTLREFGPIIHNQTTSFAVHPCMIQPSMDSDVFVL 314 >SPBC15D4.02 |||transcription factor, zf-fungal binuclear cluster type|Schizosaccharomyces pombe|chr 2|||Manual Length = 419 Score = 26.6 bits (56), Expect = 3.5 Identities = 15/50 (30%), Positives = 20/50 (40%) Frame = +1 Query: 202 CDGITTIPRPADALVYDPDLDVTKLLRE*AAEPSDSPASRPNHLVVAQVV 351 C+G T PRP+ + V+ LL E A + P L Q V Sbjct: 73 CEGYTHFPRPSGTFTASRRIPVSSLLSEPAPHGLAGQPTHPTFLYYIQSV 122 >SPAC15E1.10 ||SPAP7G5.01|PI31 proteasome regulator related|Schizosaccharomyces pombe|chr 1|||Manual Length = 265 Score = 26.6 bits (56), Expect = 3.5 Identities = 14/38 (36%), Positives = 19/38 (50%) Frame = -3 Query: 522 GSTWGNSGGVVHHVNRHIIHPNYGRWSRDNDIAIMRTS 409 GS GN GG++ N I HP SR+ + RT+ Sbjct: 175 GSDMGNDGGMIPTFNHPIFHPE--NRSRNEQASANRTN 210 >SPCC1494.07 |||conserved eukaryotic protein|Schizosaccharomyces pombe|chr 3|||Manual Length = 1502 Score = 26.2 bits (55), Expect = 4.6 Identities = 10/37 (27%), Positives = 21/37 (56%) Frame = -3 Query: 576 TAAHCIIDDAVGVWRVRVGSTWGNSGGVVHHVNRHII 466 T+A C+ + +W++R +T+G H +N+ +I Sbjct: 1347 TSAQCVTE-IWNLWKLRTKATFGGQHDFQHCINKRLI 1382 >SPAC25B8.12c |||nucleotide-sugar phosphatase |Schizosaccharomyces pombe|chr 1|||Manual Length = 303 Score = 26.2 bits (55), Expect = 4.6 Identities = 8/19 (42%), Positives = 14/19 (73%) Frame = -1 Query: 191 FALAGWTLAVATHAPVTLE 135 FA+AGW++A+ P+ +E Sbjct: 249 FAIAGWSVAIKNGMPIAIE 267 >SPBC14F5.02 |||sequence orphan|Schizosaccharomyces pombe|chr 2|||Manual Length = 515 Score = 25.8 bits (54), Expect = 6.1 Identities = 15/42 (35%), Positives = 22/42 (52%), Gaps = 3/42 (7%) Frame = -1 Query: 386 MLCNRPAFLDQTTTWATTRWFGRLAG---ESLGSAAHSLSNF 270 ++C+RP + TTW F R+ G ESL + S SN+ Sbjct: 47 IVCSRPIVDENVTTWPENEGF-RIEGTLLESLVESVTSASNY 87 >SPBC17A3.02 |||conserved fungal protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 119 Score = 25.4 bits (53), Expect = 8.1 Identities = 10/27 (37%), Positives = 15/27 (55%) Frame = -3 Query: 222 YGGNTITNNMLCAGWLDVGGRDSCTGD 142 YGG + +LC G+ +GG +GD Sbjct: 40 YGGPFVPGCLLCGGFNAIGGLAIASGD 66 >SPCC23B6.04c |||sec14 cytosolic factor family|Schizosaccharomyces pombe|chr 3|||Manual Length = 1008 Score = 25.4 bits (53), Expect = 8.1 Identities = 10/27 (37%), Positives = 15/27 (55%) Frame = -3 Query: 303 TRFGGSLSEQLRHVQVWVVNQSVCRSR 223 + FGGSL + H + W +C+SR Sbjct: 818 SNFGGSLHFEYHHEKYWPQLVELCKSR 844 >SPAC824.09c |||GTPase activating protein |Schizosaccharomyces pombe|chr 1|||Manual Length = 320 Score = 25.4 bits (53), Expect = 8.1 Identities = 11/36 (30%), Positives = 16/36 (44%) Frame = -1 Query: 161 ATHAPVTLEVRFITTTWSLV*ALSEITAVMPATLAS 54 A H P T F+ W + S +T+ P+ AS Sbjct: 260 AFHQPATTGSSFVADKWKMPMFTSNVTSAQPSARAS 295 >SPACUNK4.07c |cta4|sev4, SPAPYUK71.01|P-type ATPase, calcium transporting Cta4 |Schizosaccharomyces pombe|chr 1|||Manual Length = 1211 Score = 25.4 bits (53), Expect = 8.1 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = -2 Query: 196 HALRWLAGRWRSRL 155 HAL WLAG W +++ Sbjct: 65 HALFWLAGEWNTKV 78 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,959,831 Number of Sequences: 5004 Number of extensions: 59516 Number of successful extensions: 156 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 149 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 156 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 331187010 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -