BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV12k13f (571 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY127579-1|AAN02286.1| 405|Apis mellifera venom protease precur... 87 2e-19 AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. 27 0.17 DQ015969-1|AAY81926.1| 397|Apis mellifera stargazin related pro... 25 0.40 DQ325087-1|ABD14101.1| 179|Apis mellifera complementary sex det... 23 2.1 DQ325086-1|ABD14100.1| 179|Apis mellifera complementary sex det... 23 2.1 DQ325085-1|ABD14099.1| 179|Apis mellifera complementary sex det... 23 2.1 DQ325084-1|ABD14098.1| 179|Apis mellifera complementary sex det... 23 2.1 AB204559-1|BAD89804.1| 832|Apis mellifera soluble guanylyl cycl... 22 3.7 DQ667184-1|ABG75736.1| 489|Apis mellifera GABA-gated ion channe... 22 4.9 DQ325103-1|ABD14117.1| 182|Apis mellifera complementary sex det... 22 4.9 AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 22 4.9 AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. 22 4.9 AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. 22 4.9 AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. 22 4.9 AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. 22 4.9 AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. 22 4.9 AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. 22 4.9 AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. 22 4.9 AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex det... 22 4.9 AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex det... 22 4.9 AB022908-1|BAA86909.1| 493|Apis mellifera amylase protein. 21 8.6 >AY127579-1|AAN02286.1| 405|Apis mellifera venom protease precursor protein. Length = 405 Score = 86.6 bits (205), Expect = 2e-19 Identities = 57/156 (36%), Positives = 84/156 (53%), Gaps = 10/156 (6%) Frame = +1 Query: 88 RIVGGSTTTINRYPTIAALLMTRNWSTWSQNCGSSILNNRSVLTAAHCIIDDAVGVWRVR 267 RIVGG+ T IN +P +A + T CG++I++ R VLTAAHCIID+ + Sbjct: 160 RIVGGTNTGINEFPMMAGIKRTYEPG---MICGATIISKRYVLTAAHCIIDENTTKLAIV 216 Query: 268 VGS-TWGN----SGGVVHHVNRHIIHPNYGRWSRD----NDIAIMRTSSNINYVNNAVQP 420 VG W + + V+H +N+ IIHP Y +D NDIA+++T +I + + V P Sbjct: 217 VGEHDWSSKTETNATVLHSINKVIIHPKYDIIEKDDWQINDIALLKTEKDIKF-GDKVGP 275 Query: 421 ARIPGSNY-NLGDNQVVWAAGWGVTRFGGSLSEQLR 525 A +P ++ + V GWG T F G LS L+ Sbjct: 276 ACLPFQHFLDSFAGSDVTVLGWGHTSFNGMLSHILQ 311 >AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. Length = 898 Score = 26.6 bits (56), Expect = 0.17 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = -1 Query: 391 CCLKYA*SQYHCHETICRSLGVLCVCSRDAPRRH 290 C KY C E S +CVC R PRRH Sbjct: 82 CASKYCGIGKEC-ELSPNSTIAVCVCMRKCPRRH 114 >DQ015969-1|AAY81926.1| 397|Apis mellifera stargazin related protein STG-1 protein. Length = 397 Score = 25.4 bits (53), Expect = 0.40 Identities = 12/26 (46%), Positives = 14/26 (53%) Frame = +1 Query: 262 VRVGSTWGNSGGVVHHVNRHIIHPNY 339 VR S N GGV H N H+ H N+ Sbjct: 261 VRRDSRRKNYGGVYHLDNHHVHHANH 286 >DQ325087-1|ABD14101.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 23.0 bits (47), Expect = 2.1 Identities = 10/49 (20%), Positives = 24/49 (48%) Frame = +1 Query: 298 VVHHVNRHIIHPNYGRWSRDNDIAIMRTSSNINYVNNAVQPARIPGSNY 444 ++ ++ + IH N +++ +N+ + NINY+ P + N+ Sbjct: 81 IISSLSNNTIHNNNYKYNYNNNNYNKKLYYNINYIEQIPIPVPVYYGNF 129 >DQ325086-1|ABD14100.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 23.0 bits (47), Expect = 2.1 Identities = 10/49 (20%), Positives = 24/49 (48%) Frame = +1 Query: 298 VVHHVNRHIIHPNYGRWSRDNDIAIMRTSSNINYVNNAVQPARIPGSNY 444 ++ ++ + IH N +++ +N+ + NINY+ P + N+ Sbjct: 81 IISSLSNNTIHNNNYKYNYNNNNYNKKLYYNINYIEQIPIPVPVYYGNF 129 >DQ325085-1|ABD14099.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 23.0 bits (47), Expect = 2.1 Identities = 10/49 (20%), Positives = 24/49 (48%) Frame = +1 Query: 298 VVHHVNRHIIHPNYGRWSRDNDIAIMRTSSNINYVNNAVQPARIPGSNY 444 ++ ++ + IH N +++ +N+ + NINY+ P + N+ Sbjct: 81 IISSLSNNTIHNNNYKYNYNNNNYNKKLYYNINYIEQIPIPVPVYYGNF 129 >DQ325084-1|ABD14098.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 23.0 bits (47), Expect = 2.1 Identities = 10/49 (20%), Positives = 24/49 (48%) Frame = +1 Query: 298 VVHHVNRHIIHPNYGRWSRDNDIAIMRTSSNINYVNNAVQPARIPGSNY 444 ++ ++ + IH N +++ +N+ + NINY+ P + N+ Sbjct: 81 IISSLSNNTIHNNNYKYNYNNNNYNKKLYYNINYIEQIPIPVPVYYGNF 129 >AB204559-1|BAD89804.1| 832|Apis mellifera soluble guanylyl cyclase beta-3 protein. Length = 832 Score = 22.2 bits (45), Expect = 3.7 Identities = 12/34 (35%), Positives = 14/34 (41%) Frame = +3 Query: 87 EDRWR*YNDDKSVPNNSCPAYDQELEYLVPELRK 188 EDRW SV S + E L+P L K Sbjct: 19 EDRWEEIRRQASVEQPSFSVHQVYPENLIPRLAK 52 >DQ667184-1|ABG75736.1| 489|Apis mellifera GABA-gated ion channel protein. Length = 489 Score = 21.8 bits (44), Expect = 4.9 Identities = 9/30 (30%), Positives = 15/30 (50%) Frame = -2 Query: 201 VENRASAILGPSTPVPGHKQGSYCWVPIYR 112 + NR+ + G STP G + + P +R Sbjct: 383 IRNRSGLVSGSSTPGTGREHDPAKFPPSFR 412 >DQ325103-1|ABD14117.1| 182|Apis mellifera complementary sex determiner protein. Length = 182 Score = 21.8 bits (44), Expect = 4.9 Identities = 8/45 (17%), Positives = 21/45 (46%) Frame = +1 Query: 298 VVHHVNRHIIHPNYGRWSRDNDIAIMRTSSNINYVNNAVQPARIP 432 ++ ++ + + NY ++ + + + NINY+ P +P Sbjct: 81 IISSLSNNYNYSNYNNYNNNYNNYNKKLYYNINYIEQIPVPVPVP 125 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 21.8 bits (44), Expect = 4.9 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = +1 Query: 259 RVRVGSTWGNSGGVVHHVNRHIIHPNYG 342 R++VG +G VV H+N H N G Sbjct: 439 RLQVGQYVTVNGDVVSHLNISSTHTNDG 466 >AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.8 bits (44), Expect = 4.9 Identities = 8/16 (50%), Positives = 9/16 (56%) Frame = -2 Query: 75 RRDGRKSCEA*RENEY 28 R DG +SC R EY Sbjct: 246 RNDGERSCSRDRSREY 261 >AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.8 bits (44), Expect = 4.9 Identities = 8/16 (50%), Positives = 9/16 (56%) Frame = -2 Query: 75 RRDGRKSCEA*RENEY 28 R DG +SC R EY Sbjct: 246 RNDGERSCSRDRSREY 261 >AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.8 bits (44), Expect = 4.9 Identities = 8/16 (50%), Positives = 9/16 (56%) Frame = -2 Query: 75 RRDGRKSCEA*RENEY 28 R DG +SC R EY Sbjct: 246 RNDGERSCSRDRSREY 261 >AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.8 bits (44), Expect = 4.9 Identities = 8/16 (50%), Positives = 9/16 (56%) Frame = -2 Query: 75 RRDGRKSCEA*RENEY 28 R DG +SC R EY Sbjct: 246 RNDGERSCSRDRSREY 261 >AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.8 bits (44), Expect = 4.9 Identities = 8/16 (50%), Positives = 9/16 (56%) Frame = -2 Query: 75 RRDGRKSCEA*RENEY 28 R DG +SC R EY Sbjct: 246 RNDGERSCSRDRSREY 261 >AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.8 bits (44), Expect = 4.9 Identities = 8/16 (50%), Positives = 9/16 (56%) Frame = -2 Query: 75 RRDGRKSCEA*RENEY 28 R DG +SC R EY Sbjct: 246 RNDGERSCSRDRSREY 261 >AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. Length = 400 Score = 21.8 bits (44), Expect = 4.9 Identities = 8/16 (50%), Positives = 9/16 (56%) Frame = -2 Query: 75 RRDGRKSCEA*RENEY 28 R DG +SC R EY Sbjct: 246 RNDGERSCSRDRSREY 261 >AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex determiner protein. Length = 425 Score = 21.8 bits (44), Expect = 4.9 Identities = 11/56 (19%), Positives = 26/56 (46%) Frame = +1 Query: 265 RVGSTWGNSGGVVHHVNRHIIHPNYGRWSRDNDIAIMRTSSNINYVNNAVQPARIP 432 ++ S+ N+ ++ N + + NY ++ + + + NINY+ P +P Sbjct: 313 KIISSLSNNYKYSNYNNYNNNYNNYNNYNNNYNNNYKKLYYNINYIEQIPVPVPVP 368 >AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex determiner protein. Length = 401 Score = 21.8 bits (44), Expect = 4.9 Identities = 8/16 (50%), Positives = 9/16 (56%) Frame = -2 Query: 75 RRDGRKSCEA*RENEY 28 R DG +SC R EY Sbjct: 246 RNDGERSCSRDRSREY 261 >AB022908-1|BAA86909.1| 493|Apis mellifera amylase protein. Length = 493 Score = 21.0 bits (42), Expect = 8.6 Identities = 7/17 (41%), Positives = 9/17 (52%) Frame = +1 Query: 436 SNYNLGDNQVVWAAGWG 486 SN G+N + W WG Sbjct: 274 SNAFRGNNNLKWLVNWG 290 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 165,620 Number of Sequences: 438 Number of extensions: 3725 Number of successful extensions: 27 Number of sequences better than 10.0: 21 Number of HSP's better than 10.0 without gapping: 22 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 24 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 16381902 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -