BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV12k11f (605 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY943929-1|AAX49502.1| 755|Anopheles gambiae laccase-2 isoform ... 27 0.62 AY943928-1|AAX49501.1| 753|Anopheles gambiae laccase-2 isoform ... 27 0.62 EF117201-1|ABL67438.1| 481|Anopheles gambiae serpin 17 protein. 25 1.9 AY725820-1|AAU50568.1| 593|Anopheles gambiae fruitless female-s... 24 4.4 AY725819-1|AAU50567.1| 569|Anopheles gambiae fruitless male-spe... 24 4.4 AJ439060-17|CAD27768.1| 568|Anopheles gambiae putative chitin b... 24 4.4 AY785361-1|AAV52865.1| 960|Anopheles gambiae male-specific tran... 23 5.8 AY785360-1|AAV52864.1| 759|Anopheles gambiae male-specific tran... 23 5.8 AF080566-1|AAC31946.1| 308|Anopheles gambiae abdominal-A homeot... 23 5.8 CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskel... 23 7.7 >AY943929-1|AAX49502.1| 755|Anopheles gambiae laccase-2 isoform B protein. Length = 755 Score = 26.6 bits (56), Expect = 0.62 Identities = 13/30 (43%), Positives = 15/30 (50%) Frame = +3 Query: 354 VMYLMKLASAWLKCQRTPNCTQSCWSHLLC 443 V Y L +A C TPN T + WSH C Sbjct: 170 VEYYTVLGAACQVC--TPNATNTVWSHCQC 197 >AY943928-1|AAX49501.1| 753|Anopheles gambiae laccase-2 isoform A protein. Length = 753 Score = 26.6 bits (56), Expect = 0.62 Identities = 13/30 (43%), Positives = 15/30 (50%) Frame = +3 Query: 354 VMYLMKLASAWLKCQRTPNCTQSCWSHLLC 443 V Y L +A C TPN T + WSH C Sbjct: 170 VEYYTVLGAACQVC--TPNATNTVWSHCQC 197 >EF117201-1|ABL67438.1| 481|Anopheles gambiae serpin 17 protein. Length = 481 Score = 25.0 bits (52), Expect = 1.9 Identities = 11/22 (50%), Positives = 16/22 (72%) Frame = +1 Query: 4 PEPVINFLALYRPFFVLVVLKI 69 P P+INF A+ PF +++V KI Sbjct: 445 PPPIINF-AVNEPFLMMIVDKI 465 >AY725820-1|AAU50568.1| 593|Anopheles gambiae fruitless female-specific zinc-fingerC isoform protein. Length = 593 Score = 23.8 bits (49), Expect = 4.4 Identities = 13/41 (31%), Positives = 18/41 (43%) Frame = -1 Query: 368 HQVHYVRDLHALSVPSDELGSACSKIGSSSEVQPASPSFHS 246 +Q+H+ H + PS E G+A EV FHS Sbjct: 505 YQLHHQMSYHNMFTPSREPGTAWRCRSCGKEVTNRWHHFHS 545 Score = 23.4 bits (48), Expect = 5.8 Identities = 9/20 (45%), Positives = 10/20 (50%) Frame = +1 Query: 454 PAHGTHCHHPRPSNRQGSGG 513 P H TH HH + G GG Sbjct: 230 PTHQTHHHHHHHQHGGGVGG 249 >AY725819-1|AAU50567.1| 569|Anopheles gambiae fruitless male-specific zinc-fingerC isoform protein. Length = 569 Score = 23.8 bits (49), Expect = 4.4 Identities = 13/41 (31%), Positives = 18/41 (43%) Frame = -1 Query: 368 HQVHYVRDLHALSVPSDELGSACSKIGSSSEVQPASPSFHS 246 +Q+H+ H + PS E G+A EV FHS Sbjct: 481 YQLHHQMSYHNMFTPSREPGTAWRCRSCGKEVTNRWHHFHS 521 >AJ439060-17|CAD27768.1| 568|Anopheles gambiae putative chitin binding protein protein. Length = 568 Score = 23.8 bits (49), Expect = 4.4 Identities = 15/46 (32%), Positives = 23/46 (50%) Frame = +1 Query: 181 RGGVQHRKGPSCPAATSQDYGIL*KEGEAG*TSEEDPIFEHAEPSS 318 RGG R P+ P ++ + I+ KE A ++ P F+ A P S Sbjct: 176 RGGAAIRTAPASPFPSAPNQQIIYKEQTANLQVQKVPAFQ-AMPES 220 >AY785361-1|AAV52865.1| 960|Anopheles gambiae male-specific transcription factor FRU-MA protein. Length = 960 Score = 23.4 bits (48), Expect = 5.8 Identities = 9/20 (45%), Positives = 10/20 (50%) Frame = +1 Query: 454 PAHGTHCHHPRPSNRQGSGG 513 P H TH HH + G GG Sbjct: 278 PTHQTHHHHHHHQHGGGVGG 297 >AY785360-1|AAV52864.1| 759|Anopheles gambiae male-specific transcription factor FRU-MB protein. Length = 759 Score = 23.4 bits (48), Expect = 5.8 Identities = 9/20 (45%), Positives = 10/20 (50%) Frame = +1 Query: 454 PAHGTHCHHPRPSNRQGSGG 513 P H TH HH + G GG Sbjct: 278 PTHQTHHHHHHHQHGGGVGG 297 >AF080566-1|AAC31946.1| 308|Anopheles gambiae abdominal-A homeotic protein protein. Length = 308 Score = 23.4 bits (48), Expect = 5.8 Identities = 9/13 (69%), Positives = 11/13 (84%) Frame = -1 Query: 320 DELGSACSKIGSS 282 D LGSACS++ SS Sbjct: 72 DSLGSACSQLSSS 84 >CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskeletal structural protein protein. Length = 1645 Score = 23.0 bits (47), Expect = 7.7 Identities = 9/30 (30%), Positives = 17/30 (56%) Frame = +1 Query: 469 HCHHPRPSNRQGSGGVPARKSSTRLQE*DQ 558 H HP + QG+G +P+++ + Q+ Q Sbjct: 232 HQQHPPGAGVQGAGPIPSQQKHQQHQQQQQ 261 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 541,424 Number of Sequences: 2352 Number of extensions: 10184 Number of successful extensions: 25 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 22 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 25 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 58870980 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -