BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV12k09r (749 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. 25 3.3 DQ103706-1|AAZ43087.1| 344|Anopheles gambiae pk-1 receptor prot... 24 4.4 AJ439060-8|CAD27759.1| 808|Anopheles gambiae putative V-ATPase ... 23 7.6 >AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. Length = 3398 Score = 24.6 bits (51), Expect = 3.3 Identities = 12/26 (46%), Positives = 14/26 (53%) Frame = -3 Query: 462 TLLYDFFTVCGSKFLLHYKIQFIKLI 385 T YD T G F LHYK+Q K + Sbjct: 958 TYEYDMPTKDGDVFKLHYKVQNNKYV 983 >DQ103706-1|AAZ43087.1| 344|Anopheles gambiae pk-1 receptor protein. Length = 344 Score = 24.2 bits (50), Expect = 4.4 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = -3 Query: 618 LKRMSGIFRLICAIWIMSTPKFINIPNPHGLQYG 517 + ++S R IC IW+++ I P LQ+G Sbjct: 157 MSKLSRAVRFICVIWLIAIVSAI----PQALQFG 186 >AJ439060-8|CAD27759.1| 808|Anopheles gambiae putative V-ATPase protein. Length = 808 Score = 23.4 bits (48), Expect = 7.6 Identities = 10/25 (40%), Positives = 13/25 (52%) Frame = +2 Query: 485 FKLMKDASHCHPYCNPWGLGMFINL 559 + + D H P C P L MFIN+ Sbjct: 583 YSAVTDEDHLKPGCAPSVLIMFINM 607 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 823,851 Number of Sequences: 2352 Number of extensions: 18760 Number of successful extensions: 56 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 54 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 56 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 77339358 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -