BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV12k09r (749 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value U70841-1|AAC47455.1| 377|Apis mellifera ultraviolet sensitive o... 23 2.3 AF004168-1|AAC13417.1| 377|Apis mellifera blue-sensitive opsin ... 23 2.3 EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. 23 3.1 AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. 23 3.1 AB181702-1|BAE06051.1| 628|Apis mellifera acetylcholinesterase ... 22 7.1 >U70841-1|AAC47455.1| 377|Apis mellifera ultraviolet sensitive opsin protein. Length = 377 Score = 23.4 bits (48), Expect = 2.3 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = -3 Query: 585 CAIWIMSTPKFINIPN 538 C IWI ST K + P+ Sbjct: 77 CVIWIFSTSKSLRTPS 92 >AF004168-1|AAC13417.1| 377|Apis mellifera blue-sensitive opsin protein. Length = 377 Score = 23.4 bits (48), Expect = 2.3 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = -3 Query: 585 CAIWIMSTPKFINIPN 538 C IWI ST K + P+ Sbjct: 77 CVIWIFSTSKSLRTPS 92 >EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. Length = 683 Score = 23.0 bits (47), Expect = 3.1 Identities = 9/30 (30%), Positives = 18/30 (60%) Frame = -1 Query: 356 FYKTLMKEGRKQDWKYSYKTY*RPDTLILP 267 + + ++ E + +KYS + Y P+ L+LP Sbjct: 576 YNRLVVSEDGSETFKYSSQPYGFPERLLLP 605 >AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. Length = 683 Score = 23.0 bits (47), Expect = 3.1 Identities = 9/30 (30%), Positives = 18/30 (60%) Frame = -1 Query: 356 FYKTLMKEGRKQDWKYSYKTY*RPDTLILP 267 + + ++ E + +KYS + Y P+ L+LP Sbjct: 576 YNRLVVSEDGSETFKYSSQPYGFPERLLLP 605 >AB181702-1|BAE06051.1| 628|Apis mellifera acetylcholinesterase protein. Length = 628 Score = 21.8 bits (44), Expect = 7.1 Identities = 8/17 (47%), Positives = 9/17 (52%) Frame = -3 Query: 585 CAIWIMSTPKFINIPNP 535 CA W PK IP+P Sbjct: 574 CAFWNEFLPKLKGIPDP 590 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 220,071 Number of Sequences: 438 Number of extensions: 4768 Number of successful extensions: 7 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23510295 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -