BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV12k05r (715 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_45953| Best HMM Match : LRR_1 (HMM E-Value=7.4e-15) 33 0.30 SB_10638| Best HMM Match : Myosin_N (HMM E-Value=1.5e-06) 28 6.5 SB_38918| Best HMM Match : DUF997 (HMM E-Value=2.3) 28 8.6 >SB_45953| Best HMM Match : LRR_1 (HMM E-Value=7.4e-15) Length = 1427 Score = 32.7 bits (71), Expect = 0.30 Identities = 17/34 (50%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Frame = -3 Query: 650 AIKIRKENNRILFSVGSF-LILRNKNVYAVESKP 552 AIK+R NNR+L+ F L LR KN+Y KP Sbjct: 1293 AIKLRTGNNRVLYLQTYFHLFLRRKNIYLKFGKP 1326 >SB_10638| Best HMM Match : Myosin_N (HMM E-Value=1.5e-06) Length = 1977 Score = 28.3 bits (60), Expect = 6.5 Identities = 17/54 (31%), Positives = 26/54 (48%), Gaps = 3/54 (5%) Frame = -2 Query: 408 IYFSNNSLSICLYFVCTCTIH-IKHHWLLRL--NMSSPFDVVIIDFHCICMYLI 256 +Y S+ ICLY V I+ + LL + +S V I HC C+Y++ Sbjct: 1624 VYGYTLSVRICLYIVSAYNIYTLSVRTLLYIVSAFTSTLSVRITSIHCQCVYIV 1677 >SB_38918| Best HMM Match : DUF997 (HMM E-Value=2.3) Length = 860 Score = 27.9 bits (59), Expect = 8.6 Identities = 14/44 (31%), Positives = 20/44 (45%), Gaps = 2/44 (4%) Frame = -2 Query: 387 LSICLYFVCTCTIHIKHH--WLLRLNMSSPFDVVIIDFHCICMY 262 L+ L + C + I HH W L N+ I DF+ +C Y Sbjct: 207 LTAWLGSILFCVLQIAHHLQWRLTKNLYRDISTAIEDFNRLCEY 250 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,480,751 Number of Sequences: 59808 Number of extensions: 407118 Number of successful extensions: 771 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 737 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 771 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1889780269 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -