BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV12k05r (715 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AE014296-2119|AAS65016.1| 750|Drosophila melanogaster CG5620-PB... 29 4.7 AE014296-2118|AAF49939.2| 750|Drosophila melanogaster CG5620-PA... 29 4.7 >AE014296-2119|AAS65016.1| 750|Drosophila melanogaster CG5620-PB, isoform B protein. Length = 750 Score = 29.5 bits (63), Expect = 4.7 Identities = 16/54 (29%), Positives = 29/54 (53%), Gaps = 1/54 (1%) Frame = -2 Query: 432 KEKLRFV*IYFSNNSLSICLYFVCTCTI-HIKHHWLLRLNMSSPFDVVIIDFHC 274 K RF Y SL+ F+ +C++ H+K H + + ++PF V+++ F C Sbjct: 186 KRNYRF--FYLFLVSLAFLAVFIFSCSVTHLKEHEVFNVIKAAPFTVIVV-FIC 236 >AE014296-2118|AAF49939.2| 750|Drosophila melanogaster CG5620-PA, isoform A protein. Length = 750 Score = 29.5 bits (63), Expect = 4.7 Identities = 16/54 (29%), Positives = 29/54 (53%), Gaps = 1/54 (1%) Frame = -2 Query: 432 KEKLRFV*IYFSNNSLSICLYFVCTCTI-HIKHHWLLRLNMSSPFDVVIIDFHC 274 K RF Y SL+ F+ +C++ H+K H + + ++PF V+++ F C Sbjct: 186 KRNYRF--FYLFLVSLAFLAVFIFSCSVTHLKEHEVFNVIKAAPFTVIVV-FIC 236 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 29,115,321 Number of Sequences: 53049 Number of extensions: 574396 Number of successful extensions: 904 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 866 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 904 length of database: 24,988,368 effective HSP length: 83 effective length of database: 20,585,301 effective search space used: 3170136354 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -