BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV12k04f (582 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY242387-1|AAO72539.2| 693|Apis mellifera prophenoloxidase prot... 24 0.95 AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter... 24 1.3 AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 24 1.3 EF540769-1|ABQ14707.1| 620|Apis mellifera adenosine deaminase p... 22 3.8 AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein pr... 21 6.7 DQ667184-1|ABG75736.1| 489|Apis mellifera GABA-gated ion channe... 21 8.9 AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. 21 8.9 AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. 21 8.9 >AY242387-1|AAO72539.2| 693|Apis mellifera prophenoloxidase protein. Length = 693 Score = 24.2 bits (50), Expect = 0.95 Identities = 31/123 (25%), Positives = 55/123 (44%), Gaps = 8/123 (6%) Frame = +1 Query: 235 LDLTAMTIPDLSNALQDPKTEP--AMIP---YLGQALNEVVTAVLTGQSQVATPVII-PA 396 L + A+T+PDLS +Q + +P IP + L ++ + T + ++ V Sbjct: 60 LPVKAITLPDLSIPMQLGRRQPFSLFIPAHRKIAARLIDIFMGMRTYEDFLSVAVYCRDR 119 Query: 397 MEVSLWTLTEISAALESPVTNPVLVPYLENAL-NVIMDA-MFAGHEVTSICVSIPAGVPL 570 + +L+ A L P T + VP L + MD+ +F+ + V A VP+ Sbjct: 120 LNPNLFIYALSVAILHRPDTKDLPVPPLTEVFPDKYMDSGIFSRAREEANVVPEGARVPI 179 Query: 571 ELP 579 E+P Sbjct: 180 EIP 182 >AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 593 Score = 23.8 bits (49), Expect = 1.3 Identities = 8/25 (32%), Positives = 14/25 (56%) Frame = -2 Query: 389 IITGVATWLCPVRTAVTTSLSAWPR 315 I+ G+ + C V +T ++ WPR Sbjct: 385 ILIGLDSQFCTVEGFITAAVDEWPR 409 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 23.8 bits (49), Expect = 1.3 Identities = 8/25 (32%), Positives = 14/25 (56%) Frame = -2 Query: 389 IITGVATWLCPVRTAVTTSLSAWPR 315 I+ G+ + C V +T ++ WPR Sbjct: 438 ILIGLDSQFCTVEGFITAAVDEWPR 462 >EF540769-1|ABQ14707.1| 620|Apis mellifera adenosine deaminase protein. Length = 620 Score = 22.2 bits (45), Expect = 3.8 Identities = 8/19 (42%), Positives = 11/19 (57%) Frame = +3 Query: 366 PGCHSSDYPCYGSLPLDPD 422 P H + C S+PL+PD Sbjct: 104 PEVHQAINTCQPSIPLEPD 122 >AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein protein. Length = 1308 Score = 21.4 bits (43), Expect = 6.7 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = +1 Query: 466 LVPYLENALNVIMDAMFAGHEVTS 537 LVPYLEN N + + AG + S Sbjct: 471 LVPYLENKGNGVYAWIGAGRDSDS 494 >DQ667184-1|ABG75736.1| 489|Apis mellifera GABA-gated ion channel protein. Length = 489 Score = 21.0 bits (42), Expect = 8.9 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = +1 Query: 28 MKFITVFAAILSVAFGYQTTW 90 M F+ VFAA+L A T W Sbjct: 310 MCFVFVFAALLEYAAVNYTYW 330 >AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. Length = 652 Score = 21.0 bits (42), Expect = 8.9 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = -1 Query: 258 NGHCGEVQSGNGNGYSFN 205 N + G +GNGNG S N Sbjct: 249 NNNNGANDNGNGNGASNN 266 >AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. Length = 554 Score = 21.0 bits (42), Expect = 8.9 Identities = 14/34 (41%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Frame = +3 Query: 321 PG-AQRGRHRRPDWTKPGCHSSDYPCYGSLPLDP 419 PG AQ GR P +T ++ P GSLP P Sbjct: 215 PGHAQMGR---PSYTTATMATTSTPGSGSLPASP 245 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.317 0.130 0.367 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 164,809 Number of Sequences: 438 Number of extensions: 3657 Number of successful extensions: 9 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 16870914 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -