BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV12j24r (715 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ071552-1|AAY82248.1| 495|Apis mellifera anarchy 1 protein. 25 0.94 AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamat... 24 1.6 >DQ071552-1|AAY82248.1| 495|Apis mellifera anarchy 1 protein. Length = 495 Score = 24.6 bits (51), Expect = 0.94 Identities = 10/24 (41%), Positives = 13/24 (54%) Frame = +2 Query: 218 YLC*NLHTFLWTSGVLVGGFCGCT 289 Y+C LHT +W +G G CT Sbjct: 83 YVCRVLHTTVWVAGAQRGNEQRCT 106 >AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamate receptor protein. Length = 1040 Score = 23.8 bits (49), Expect = 1.6 Identities = 11/33 (33%), Positives = 15/33 (45%) Frame = -1 Query: 490 HGSILHGTCSSDAIQLEEHHEGWNWADLEELAV 392 H I HG S ++ L H E +W +E V Sbjct: 81 HHPIRHGRRQSRSMDLNAHREQMSWPVKKEAVV 113 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 187,036 Number of Sequences: 438 Number of extensions: 3836 Number of successful extensions: 9 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22048515 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -