BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV12j17r (651 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 24 1.5 AJ849455-1|CAH60991.1| 366|Apis mellifera twist protein protein. 23 2.6 AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. 23 3.4 AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. 23 3.4 AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. 23 3.4 EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. 22 4.5 AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. 22 4.5 AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. 22 4.5 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 23.8 bits (49), Expect = 1.5 Identities = 11/39 (28%), Positives = 21/39 (53%) Frame = +2 Query: 428 LRGEVVKRTLELLKFDVMLEQMLDIMTSLVLNYVKEITE 544 L G ++ LKF + +LD + +L+ NY++ + E Sbjct: 872 LEGNLMINNKYALKFFPFDKHILDKLPTLISNYIEAVKE 910 Score = 23.0 bits (47), Expect = 2.6 Identities = 14/33 (42%), Positives = 18/33 (54%), Gaps = 3/33 (9%) Frame = -3 Query: 235 DIIGEFPKDKLAALYEQ---KLAEDEEFRVALE 146 DI E P D L ALY Q L+E + V+L+ Sbjct: 1338 DISMEVPSDALIALYSQGLFSLSEIDNLDVSLD 1370 >AJ849455-1|CAH60991.1| 366|Apis mellifera twist protein protein. Length = 366 Score = 23.0 bits (47), Expect = 2.6 Identities = 17/57 (29%), Positives = 28/57 (49%), Gaps = 3/57 (5%) Frame = -3 Query: 289 VKRARHTLSGRDFTSYINDIIGEFPKDKLAALYEQKLAE---DEEFRVALENLQSEE 128 V+ + T S + + + II P DKL+ + KLA D F+V N+++ E Sbjct: 260 VRERQRTQSLNEAFAALRKIIPTLPSDKLSKIQTLKLATRYIDFLFQVLHCNMENTE 316 >AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 22.6 bits (46), Expect = 3.4 Identities = 10/36 (27%), Positives = 22/36 (61%) Frame = -3 Query: 235 DIIGEFPKDKLAALYEQKLAEDEEFRVALENLQSEE 128 D++ P+D A+ + KLA + + V +E ++++E Sbjct: 81 DVVAVDPEDMYLAVKDNKLASNAGYNV-IEQVRTKE 115 >AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 22.6 bits (46), Expect = 3.4 Identities = 10/36 (27%), Positives = 22/36 (61%) Frame = -3 Query: 235 DIIGEFPKDKLAALYEQKLAEDEEFRVALENLQSEE 128 D++ P+D A+ + KLA + + V +E ++++E Sbjct: 81 DVVAVDPEDMYLAVKDNKLASNAGYNV-IEQVRTKE 115 >AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 22.6 bits (46), Expect = 3.4 Identities = 10/36 (27%), Positives = 22/36 (61%) Frame = -3 Query: 235 DIIGEFPKDKLAALYEQKLAEDEEFRVALENLQSEE 128 D++ P+D A+ + KLA + + V +E ++++E Sbjct: 81 DVVAVDPEDMYLAVKDNKLASNAGYNV-IEQVRTKE 115 >EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. Length = 683 Score = 22.2 bits (45), Expect = 4.5 Identities = 17/52 (32%), Positives = 25/52 (48%) Frame = +2 Query: 2 VLSEDGEEFFHEDVYVNTVFSKGINFGLELLTLPQSTEHGVPFLALKVLKSY 157 V+SEDG E F S+ F E L LP+ + G+P+ L V+ + Sbjct: 580 VVSEDGSETFKYS-------SQPYGFP-ERLLLPKGKKEGMPYNVLVVVSPF 623 >AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. Length = 683 Score = 22.2 bits (45), Expect = 4.5 Identities = 17/52 (32%), Positives = 25/52 (48%) Frame = +2 Query: 2 VLSEDGEEFFHEDVYVNTVFSKGINFGLELLTLPQSTEHGVPFLALKVLKSY 157 V+SEDG E F S+ F E L LP+ + G+P+ L V+ + Sbjct: 580 VVSEDGSETFKYS-------SQPYGFP-ERLLLPKGKKEGMPYNVLVVVSPF 623 >AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. Length = 554 Score = 22.2 bits (45), Expect = 4.5 Identities = 10/37 (27%), Positives = 16/37 (43%) Frame = +2 Query: 44 YVNTVFSKGINFGLELLTLPQSTEHGVPFLALKVLKS 154 YVN++++ G F P GVP ++ S Sbjct: 379 YVNSMYASGAQFATPCTPSPPRGPGGVPTSVIQAATS 415 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 149,315 Number of Sequences: 438 Number of extensions: 2983 Number of successful extensions: 14 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19682733 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -