BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV12j14r (363 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY127579-1|AAN02286.1| 405|Apis mellifera venom protease precur... 21 5.9 DQ667193-1|ABG75745.1| 510|Apis mellifera cys-loop ligand-gated... 20 7.8 >AY127579-1|AAN02286.1| 405|Apis mellifera venom protease precursor protein. Length = 405 Score = 20.6 bits (41), Expect = 5.9 Identities = 6/18 (33%), Positives = 11/18 (61%) Frame = +2 Query: 227 FAMVATHCLLEEPRCNLA 280 + + A HC+++E LA Sbjct: 197 YVLTAAHCIIDENTTKLA 214 >DQ667193-1|ABG75745.1| 510|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 510 Score = 20.2 bits (40), Expect = 7.8 Identities = 6/33 (18%), Positives = 18/33 (54%) Frame = -3 Query: 250 TVRRYHGESHFKPPTMDELPVPKGSWQSHHDAN 152 T+ + G +F E+P+ + W++ ++++ Sbjct: 321 TLLEFAGVHYFTKVGSGEIPLEEEEWENENESD 353 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 103,694 Number of Sequences: 438 Number of extensions: 1852 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 146,343 effective HSP length: 51 effective length of database: 124,005 effective search space used: 8556345 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.8 bits)
- SilkBase 1999-2023 -