BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV12j12r (614 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase... 21 7.2 Z26318-1|CAA81227.1| 544|Apis mellifera royal jelly protein RJP... 21 9.6 AY855337-1|AAW47987.1| 510|Apis mellifera tyrosine hydroxylase ... 21 9.6 >AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase protein. Length = 1143 Score = 21.4 bits (43), Expect = 7.2 Identities = 6/16 (37%), Positives = 12/16 (75%) Frame = -3 Query: 390 DMLWMMPLVASKSSPV 343 D LW++P ++ ++PV Sbjct: 386 DWLWIVPPISGSATPV 401 >Z26318-1|CAA81227.1| 544|Apis mellifera royal jelly protein RJP57-1 protein. Length = 544 Score = 21.0 bits (42), Expect = 9.6 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = +2 Query: 362 ATSGIIHSISTAPLLSFHLYY 424 A S + +++ +PLLS LYY Sbjct: 260 ALSPVTNNLYYSPLLSHGLYY 280 >AY855337-1|AAW47987.1| 510|Apis mellifera tyrosine hydroxylase protein. Length = 510 Score = 21.0 bits (42), Expect = 9.6 Identities = 9/32 (28%), Positives = 16/32 (50%) Frame = +2 Query: 341 STGLLLEATSGIIHSISTAPLLSFHLYYFAQY 436 +TG L +G++ S L+F ++ QY Sbjct: 290 NTGFTLRPAAGLLTSRDFLSSLAFRVFQSTQY 321 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 150,440 Number of Sequences: 438 Number of extensions: 2890 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 18215697 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -