BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV12j02r (785 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_05_1275 - 35395228-35395642,35396682-35397250 34 0.15 02_05_0397 + 28641033-28641231,28641385-28641485,28642012-286420... 33 0.34 07_03_0376 + 17437308-17437536,17438049-17438149,17438246-174384... 32 0.59 03_01_0056 - 471338-471919,472013-472213 32 0.59 10_08_0818 + 20801061-20801298,20801409-20801509,20801600-208018... 30 1.8 04_03_0690 + 18751601-18753667 30 1.8 04_03_0314 - 14238620-14240128 30 1.8 03_02_0309 - 7307241-7307715,7309383-7309591,7309730-7309830,730... 30 1.8 05_05_0318 + 24052022-24053858,24053935-24054132,24054363-24055351 30 2.4 02_01_0220 + 1444219-1444414,1444535-1444635,1445449-1446174 30 2.4 05_03_0168 - 9116648-9117775,9118699-9118885,9119724-9119821,911... 29 4.2 03_06_0486 - 34261577-34261692,34261830-34262094,34263164-342632... 29 4.2 08_01_0848 + 8321717-8322198,8322297-8322687 28 7.3 06_03_1254 - 28773066-28773489,28773580-28773773,28773849-28774103 28 7.3 05_07_0179 + 28195929-28195954,28195966-28196286,28196397-281966... 28 7.3 05_03_0419 - 13707843-13707860,13707936-13708010,13708251-137082... 28 7.3 02_05_1074 - 33904518-33904697,33904886-33904985,33905085-339053... 28 7.3 12_02_1081 + 25914180-25914371,25918121-25919104 28 9.7 10_08_0465 + 18125859-18125876,18126214-18126555 28 9.7 04_01_0579 - 7515242-7516241,7516366-7516393,7516574-7516631 28 9.7 02_02_0431 - 10152228-10152352,10152688-10152919,10153602-101538... 28 9.7 >02_05_1275 - 35395228-35395642,35396682-35397250 Length = 327 Score = 33.9 bits (74), Expect = 0.15 Identities = 21/53 (39%), Positives = 25/53 (47%) Frame = -1 Query: 398 NFHRYQLEWTPDFISFRIDDSEIGRVTPGNGGFWEYGGFNNRPGIHNPWRYGS 240 +FH Y + WT D I F +DD I R + G GF RP W YGS Sbjct: 176 DFHHYAILWTSDHIIFLVDDVPIRRYGRRSAG--GAAGFPARP----MWVYGS 222 >02_05_0397 + 28641033-28641231,28641385-28641485,28642012-28642068, 28642087-28642295,28642378-28642924 Length = 370 Score = 32.7 bits (71), Expect = 0.34 Identities = 16/32 (50%), Positives = 18/32 (56%), Gaps = 2/32 (6%) Frame = -1 Query: 392 HRYQLEWTPDFISFRIDDSEIGRVT--PGNGG 303 HRY + W P I F IDD+ I V PG GG Sbjct: 177 HRYSVLWAPTHIIFYIDDTPIREVIRHPGMGG 208 >07_03_0376 + 17437308-17437536,17438049-17438149,17438246-17438463, 17438544-17438901 Length = 301 Score = 31.9 bits (69), Expect = 0.59 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = -1 Query: 398 NFHRYQLEWTPDFISFRIDDSEIGR 324 +FH Y + W PD I+F +DD I R Sbjct: 169 DFHHYAILWNPDAITFFVDDVPIRR 193 >03_01_0056 - 471338-471919,472013-472213 Length = 260 Score = 31.9 bits (69), Expect = 0.59 Identities = 15/43 (34%), Positives = 19/43 (44%), Gaps = 6/43 (13%) Frame = -1 Query: 398 NFHRYQLEWTPDFISFRIDDSEIGRVTPGNGG------FWEYG 288 +FH Y + W PD I F +DD + R G W YG Sbjct: 126 DFHHYAILWNPDHIVFLVDDVPVRRYPRAAGNTFPDRQMWAYG 168 >10_08_0818 + 20801061-20801298,20801409-20801509,20801600-20801817, 20802461-20802824 Length = 306 Score = 30.3 bits (65), Expect = 1.8 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = -1 Query: 395 FHRYQLEWTPDFISFRIDDSEIGR 324 FH Y + W PD I F +DD I R Sbjct: 173 FHHYAILWNPDQILFLVDDVPIRR 196 >04_03_0690 + 18751601-18753667 Length = 688 Score = 30.3 bits (65), Expect = 1.8 Identities = 16/44 (36%), Positives = 22/44 (50%), Gaps = 1/44 (2%) Frame = -1 Query: 434 HWVRRNSAGYDTNFHRY-QLEWTPDFISFRIDDSEIGRVTPGNG 306 HW+RR N Y ++ WT +SF DD+ GR G+G Sbjct: 546 HWIRRRRGKIRQNSKNYLRISWT-KVLSFLKDDAHGGRSGSGSG 588 >04_03_0314 - 14238620-14240128 Length = 502 Score = 30.3 bits (65), Expect = 1.8 Identities = 13/21 (61%), Positives = 15/21 (71%) Frame = +1 Query: 397 LVSYPALFLLTQCAFSHPLSP 459 ++ YPALF L Q SHPLSP Sbjct: 129 VLRYPALFRLFQAPTSHPLSP 149 >03_02_0309 - 7307241-7307715,7309383-7309591,7309730-7309830, 7309918-7310149 Length = 338 Score = 30.3 bits (65), Expect = 1.8 Identities = 11/26 (42%), Positives = 17/26 (65%) Frame = -1 Query: 398 NFHRYQLEWTPDFISFRIDDSEIGRV 321 +FHRY + W+ D I F +D++ I V Sbjct: 167 DFHRYAIRWSHDTIIFYVDETPIREV 192 >05_05_0318 + 24052022-24053858,24053935-24054132,24054363-24055351 Length = 1007 Score = 29.9 bits (64), Expect = 2.4 Identities = 8/18 (44%), Positives = 13/18 (72%) Frame = +2 Query: 527 CFCCLWIRQGRFPQKLAR 580 CFCC+W++ G F + L + Sbjct: 108 CFCCIWLKNGLFNRDLVK 125 >02_01_0220 + 1444219-1444414,1444535-1444635,1445449-1446174 Length = 340 Score = 29.9 bits (64), Expect = 2.4 Identities = 16/35 (45%), Positives = 18/35 (51%), Gaps = 2/35 (5%) Frame = -1 Query: 401 TNFHRYQLEWTPDFISFRIDDSEIGRV--TPGNGG 303 T FHRY + WT I F +DD I V TP G Sbjct: 154 TEFHRYSILWTRAAIVFFVDDVPIREVRRTPAMTG 188 >05_03_0168 - 9116648-9117775,9118699-9118885,9119724-9119821, 9119948-9120114,9122242-9122578 Length = 638 Score = 29.1 bits (62), Expect = 4.2 Identities = 25/72 (34%), Positives = 32/72 (44%), Gaps = 6/72 (8%) Frame = +3 Query: 234 HLTSISPRVMNTGSIVEAAV----FPKATISRSDTTDLRV-VNSKAYEIWCPFQLVTMEI 398 H+T SPR M TG I AV P ++ TT V SK + CPF + I Sbjct: 434 HMTLTSPRAMVTGQIFGVAVGSILCPCVFLAFQSTTKPNAPVGSKQSDYPCPFAGLYRAI 493 Query: 399 SVV-SGAVPSDP 431 V+ +G V P Sbjct: 494 GVIGTGGVKELP 505 >03_06_0486 - 34261577-34261692,34261830-34262094,34263164-34263277, 34263371-34264795 Length = 639 Score = 29.1 bits (62), Expect = 4.2 Identities = 18/58 (31%), Positives = 24/58 (41%) Frame = -2 Query: 550 SNPEATKTCSSTVYTLVHRKLVRHCTTDLSPD*ADGKKRTGSEGTAPDTTLISIVTNW 377 + P+AT S +Y VHR+L R D +R G+AP TT W Sbjct: 265 NGPDATDFLVSNLYAAVHREL-RGLLWDQREQNVQHDQRPDQPGSAPSTTASDNQDQW 321 >08_01_0848 + 8321717-8322198,8322297-8322687 Length = 290 Score = 28.3 bits (60), Expect = 7.3 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = -1 Query: 398 NFHRYQLEWTPDFISFRIDD 339 +FH Y++ W P I F++DD Sbjct: 147 DFHTYKIIWNPQNIIFQVDD 166 >06_03_1254 - 28773066-28773489,28773580-28773773,28773849-28774103 Length = 290 Score = 28.3 bits (60), Expect = 7.3 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 398 NFHRYQLEWTPDFISFRIDDSEI 330 +FH Y + W P I F +DD I Sbjct: 136 DFHTYSILWNPKHIIFMVDDMPI 158 >05_07_0179 + 28195929-28195954,28195966-28196286,28196397-28196664, 28203206-28203667 Length = 358 Score = 28.3 bits (60), Expect = 7.3 Identities = 23/71 (32%), Positives = 30/71 (42%), Gaps = 2/71 (2%) Frame = +1 Query: 454 SPGKGP*CSVEPASCVP-MCRPL-RNMFLLPLDSTRSISPEAGQVPYLLYAGINQIAGQS 627 S G+ P V +SCV R + N L R +P G VPY L + + G+S Sbjct: 6 SGGRAPTKDVARSSCVSKQWRDIVTNPSFRKLHHDRHAAPPKGDVPYALLVSTDSVDGES 65 Query: 628 QSPEGIFALTS 660 S AL S Sbjct: 66 VSTVFPAALVS 76 >05_03_0419 - 13707843-13707860,13707936-13708010,13708251-13708286, 13709718-13709765,13710246-13710326,13710503-13710554, 13710671-13710730,13711266-13711346,13711461-13711577, 13711714-13711754,13711981-13712059,13712136-13712292, 13712586-13712718,13712799-13712926,13715152-13715314 Length = 422 Score = 28.3 bits (60), Expect = 7.3 Identities = 12/40 (30%), Positives = 20/40 (50%) Frame = +1 Query: 70 VGSQPPWPFQKSVAAIGELFHQGLGIGFLTPSGKKPLVPP 189 V S W F A+ + G + +++PSG+K L+ P Sbjct: 345 VNSYIAWDFSLQQGALNMVLDIGFHVEYISPSGQKTLILP 384 >02_05_1074 - 33904518-33904697,33904886-33904985,33905085-33905311, 33905511-33908384,33908467-33908643,33908786-33909008, 33909727-33909806,33910657-33910817,33910892-33910937, 33911129-33911251,33911730-33911804,33911920-33912120 Length = 1488 Score = 28.3 bits (60), Expect = 7.3 Identities = 12/29 (41%), Positives = 16/29 (55%) Frame = +3 Query: 30 EGSVLTIVNVQIPRRKPTALAIPEICGCH 116 EG++L++VN PT L E CG H Sbjct: 1185 EGAILSVVNCSTESFSPTILFSTEHCGIH 1213 >12_02_1081 + 25914180-25914371,25918121-25919104 Length = 391 Score = 27.9 bits (59), Expect = 9.7 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = -3 Query: 555 PCRIQRQQKHVPQRSTH 505 PCR++RQ+ H P+R H Sbjct: 15 PCRLRRQELHRPRRPNH 31 >10_08_0465 + 18125859-18125876,18126214-18126555 Length = 119 Score = 27.9 bits (59), Expect = 9.7 Identities = 13/37 (35%), Positives = 15/37 (40%) Frame = -1 Query: 404 DTNFHRYQLEWTPDFISFRIDDSEIGRVTPGNGGFWE 294 D H + E DF+ R G V PG G WE Sbjct: 25 DYGAHSWVYEGIADFVRLRAGYPAAGWVQPGQGNSWE 61 >04_01_0579 - 7515242-7516241,7516366-7516393,7516574-7516631 Length = 361 Score = 27.9 bits (59), Expect = 9.7 Identities = 11/32 (34%), Positives = 17/32 (53%) Frame = -1 Query: 227 FDQKFYLIINLAVGGTNGFFPDGVKNPIPKPW 132 F + YL+ +L G TN + G K +P+ W Sbjct: 300 FKENDYLLFHLTPGETNHYIIGGPKEIVPRNW 331 >02_02_0431 - 10152228-10152352,10152688-10152919,10153602-10153808, 10153915-10154034,10154114-10154260,10155080-10155147, 10155502-10155667,10156765-10156914,10157219-10157335, 10158177-10158281,10159050-10159147,10159594-10159763, 10161489-10161511,10161927-10162006,10162191-10162259, 10163198-10163442,10163614-10163810 Length = 772 Score = 27.9 bits (59), Expect = 9.7 Identities = 20/73 (27%), Positives = 32/73 (43%), Gaps = 5/73 (6%) Frame = -1 Query: 572 ASGEIDLVESRGNKNMFLNGLH-----IGTQEAGSTLHYGPFPGLSGWEKAHWVRRNSAG 408 ASGE+ L + G + + L + IG G + P+ G W+ A W +G Sbjct: 303 ASGEVALTAAGGLRKIGLGETYESPSLIGIHYEGKFYEFVPWTGTVSWDIAPWGHWKLSG 362 Query: 407 YDTNFHRYQLEWT 369 + N H ++E T Sbjct: 363 ENKN-HLVEIEAT 374 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 25,186,149 Number of Sequences: 37544 Number of extensions: 625771 Number of successful extensions: 1693 Number of sequences better than 10.0: 21 Number of HSP's better than 10.0 without gapping: 1628 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1693 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2115411120 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -