BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV12i22f (573 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC22F8.02c |pvg5|mug50|PvGal biosynthesis protein Pvg5|Schizos... 26 3.4 SPAC688.08 |srb8|med12|mediator complex subunit Srb8 |Schizosacc... 25 6.0 SPCC1322.16 |phb2||prohibitin Phb2|Schizosaccharomyces pombe|chr... 25 7.9 SPAPB1A10.07c |||sphingolipid biosynthesis protein|Schizosacchar... 25 7.9 >SPAC22F8.02c |pvg5|mug50|PvGal biosynthesis protein Pvg5|Schizosaccharomyces pombe|chr 1|||Manual Length = 372 Score = 26.2 bits (55), Expect = 3.4 Identities = 18/75 (24%), Positives = 30/75 (40%), Gaps = 1/75 (1%) Frame = -3 Query: 373 IFLFGYFKELVQPLFGLKVNIA*DIKITYPVTHK*MCCFRLFVPWKTLANMNALSATAPI 194 +FLFG L++PL +K YP+ H+ + + + A + + I Sbjct: 20 LFLFGSLILLLRPLIFYSNTTMKKLKTEYPIYHRHLSALKRNFYYTMDAQLGGIRNVVLI 79 Query: 193 -RTCVTVFTTFSTIM 152 R C F T+M Sbjct: 80 NRPCFAASDNFLTLM 94 >SPAC688.08 |srb8|med12|mediator complex subunit Srb8 |Schizosaccharomyces pombe|chr 1|||Manual Length = 1233 Score = 25.4 bits (53), Expect = 6.0 Identities = 13/30 (43%), Positives = 20/30 (66%), Gaps = 2/30 (6%) Frame = -1 Query: 135 VFEPFVGYWLRYELDLPAA--EEAVGAASY 52 VFE + + L LDLPAA ++ +GA++Y Sbjct: 965 VFEHLLLFSLEERLDLPAAFLQDLIGASAY 994 >SPCC1322.16 |phb2||prohibitin Phb2|Schizosaccharomyces pombe|chr 3|||Manual Length = 279 Score = 25.0 bits (52), Expect = 7.9 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = +3 Query: 510 SLIGGVVNLIFPKQTSALI 566 S IGG+ NLI+P+ T LI Sbjct: 49 SRIGGIKNLIYPEGTHFLI 67 >SPAPB1A10.07c |||sphingolipid biosynthesis protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 441 Score = 25.0 bits (52), Expect = 7.9 Identities = 12/52 (23%), Positives = 29/52 (55%), Gaps = 1/52 (1%) Frame = +3 Query: 198 GAVAL-SAFIFANVFHGTNNLKQHIYLCVTGYVILMSQAILTFSPNNGWTNS 350 G V + S+F+ +V TN+++ ++ ++ V+ ++L++ + W NS Sbjct: 17 GVVGIASSFLVTSVLSLTNSIQSNVGAVISYAVLYFVNSLLSWCMLSSWFNS 68 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,096,629 Number of Sequences: 5004 Number of extensions: 40398 Number of successful extensions: 92 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 89 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 92 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 244081442 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -