BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV12i17r (745 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY645021-1|AAT92557.1| 163|Anopheles gambiae even-skipped protein. 29 0.20 AB090823-2|BAC57922.1| 1154|Anopheles gambiae reverse transcript... 25 2.5 AJ439353-6|CAD27928.1| 695|Anopheles gambiae putative G-protein... 24 4.3 AJ439060-10|CAD27761.1| 1197|Anopheles gambiae putative FGF-sign... 24 4.3 AJ439060-14|CAD27765.1| 471|Anopheles gambiae putative acetyltr... 23 7.5 AB090815-2|BAC57906.1| 973|Anopheles gambiae reverse transcript... 23 10.0 >AY645021-1|AAT92557.1| 163|Anopheles gambiae even-skipped protein. Length = 163 Score = 28.7 bits (61), Expect = 0.20 Identities = 13/31 (41%), Positives = 17/31 (54%) Frame = +1 Query: 313 PAPYVPIQIKNSQRSQCDTTSKTNTHQLYRQ 405 P+PY P+ + SQ DT T HQL+ Q Sbjct: 47 PSPYAPLSMSKSQTPPQDTVG-TAQHQLHHQ 76 >AB090823-2|BAC57922.1| 1154|Anopheles gambiae reverse transcriptase protein. Length = 1154 Score = 25.0 bits (52), Expect = 2.5 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = -1 Query: 676 GSAECVRAISSRGREDKIRLSAKMARMEMPQLQHQTNSR 560 G + + S R E + + A+MAR+ QHQ + R Sbjct: 1071 GERPSMPSSSPRTSERRANIRARMARLRQRHRQHQQDER 1109 >AJ439353-6|CAD27928.1| 695|Anopheles gambiae putative G-protein coupled receptor protein. Length = 695 Score = 24.2 bits (50), Expect = 4.3 Identities = 7/22 (31%), Positives = 14/22 (63%) Frame = -2 Query: 342 LYLYWNVRSGVSNLELHRYHWI 277 +Y+ ++ S + E+HRY W+ Sbjct: 302 VYVLFSYASSIDRFEVHRYCWM 323 >AJ439060-10|CAD27761.1| 1197|Anopheles gambiae putative FGF-signaling promoter protein. Length = 1197 Score = 24.2 bits (50), Expect = 4.3 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +3 Query: 408 QVEVECDTTRINMHYINDVP 467 QV+ + IN+HY+ND P Sbjct: 686 QVDGSSGASAINIHYLNDRP 705 >AJ439060-14|CAD27765.1| 471|Anopheles gambiae putative acetyltransferase protein. Length = 471 Score = 23.4 bits (48), Expect = 7.5 Identities = 16/57 (28%), Positives = 29/57 (50%) Frame = -3 Query: 536 PVGTTIETTTNESQA*TSRGRYVWHIIYVVHVDSSCVTLHLNLSCLYN**VLVFDVV 366 PVG+T+E T + +W+I +V+ +S VTL + Y +V+D++ Sbjct: 411 PVGSTLEVETGPPPEKLCVDQLIWNIRNIVYNQTS-VTLRKH-KAAYKGDEIVYDLL 465 >AB090815-2|BAC57906.1| 973|Anopheles gambiae reverse transcriptase protein. Length = 973 Score = 23.0 bits (47), Expect = 10.0 Identities = 11/34 (32%), Positives = 20/34 (58%) Frame = +1 Query: 499 LSLVVVSIVVPTGLLLLGLAPCCWFDVVAEASPS 600 +++ V++ +VP L+L + CC F V+ A S Sbjct: 803 VAVCVIASMVPICLILAEDSECCSFSGVSNAGLS 836 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 768,225 Number of Sequences: 2352 Number of extensions: 15594 Number of successful extensions: 66 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 66 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 66 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 76507752 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -