BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV12i16r (386 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR954257-3|CAJ14154.1| 277|Anopheles gambiae predicted protein ... 23 3.9 AJ439060-1|CAD27752.1| 763|Anopheles gambiae hypothetical prote... 23 3.9 AJ438610-9|CAD27481.1| 763|Anopheles gambiae hypothetical prote... 23 3.9 U03849-2|AAA53489.1| 1049|Anopheles gambiae putative reverse tra... 22 6.8 DQ013245-1|AAY34441.1| 487|Anopheles gambiae adrenodoxin reduct... 22 6.8 AY785361-1|AAV52865.1| 960|Anopheles gambiae male-specific tran... 22 6.8 AY785360-1|AAV52864.1| 759|Anopheles gambiae male-specific tran... 22 6.8 AY725820-1|AAU50568.1| 593|Anopheles gambiae fruitless female-s... 22 6.8 AY725819-1|AAU50567.1| 569|Anopheles gambiae fruitless male-spe... 22 6.8 AY324315-1|AAQ89700.1| 153|Anopheles gambiae insulin-like pepti... 22 6.8 AY324314-1|AAQ89699.1| 153|Anopheles gambiae insulin-like pepti... 22 6.8 AY324307-1|AAQ89692.1| 154|Anopheles gambiae insulin-like pepti... 22 6.8 DQ004399-1|AAY21238.1| 847|Anopheles gambiae lysozyme c-6 protein. 22 9.0 AY578800-1|AAT07305.1| 379|Anopheles gambiae decapentaplegic pr... 22 9.0 >CR954257-3|CAJ14154.1| 277|Anopheles gambiae predicted protein protein. Length = 277 Score = 23.0 bits (47), Expect = 3.9 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = +2 Query: 317 RKNCPQTEYCCRYRYRLQ 370 R++ QTEY CR Y L+ Sbjct: 238 RQHAKQTEYQCRLTYVLE 255 >AJ439060-1|CAD27752.1| 763|Anopheles gambiae hypothetical protein protein. Length = 763 Score = 23.0 bits (47), Expect = 3.9 Identities = 16/50 (32%), Positives = 21/50 (42%), Gaps = 2/50 (4%) Frame = +3 Query: 135 QGWSSCSKIHQDYAKPDAEYRTQLHHILSPHIHTEGS--KPYASSNLRGS 278 Q +S S +KP + + QLH PH T S +P SS S Sbjct: 7 QPTASSSTTSSSSSKPSPQQQQQLHSADVPHSSTSQSSRRPQHSSTSASS 56 >AJ438610-9|CAD27481.1| 763|Anopheles gambiae hypothetical protein protein. Length = 763 Score = 23.0 bits (47), Expect = 3.9 Identities = 16/50 (32%), Positives = 21/50 (42%), Gaps = 2/50 (4%) Frame = +3 Query: 135 QGWSSCSKIHQDYAKPDAEYRTQLHHILSPHIHTEGS--KPYASSNLRGS 278 Q +S S +KP + + QLH PH T S +P SS S Sbjct: 7 QPTASSSTTSSSSSKPSPQQQQQLHSADVPHSSTSQSSRRPQHSSTSASS 56 >U03849-2|AAA53489.1| 1049|Anopheles gambiae putative reverse transcriptase protein. Length = 1049 Score = 22.2 bits (45), Expect = 6.8 Identities = 9/16 (56%), Positives = 12/16 (75%) Frame = -3 Query: 384 SLYNTCNRYRYRQQYS 337 SLY + NR+RYR+ S Sbjct: 442 SLYCSYNRFRYRRYLS 457 >DQ013245-1|AAY34441.1| 487|Anopheles gambiae adrenodoxin reductase protein. Length = 487 Score = 22.2 bits (45), Expect = 6.8 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = -3 Query: 231 VCVGIGCGGAVFYTLRLALRNPDVS 157 +C+ +G G A FYT + L++ D S Sbjct: 33 ICI-VGAGPAGFYTAQYILKHLDNS 56 >AY785361-1|AAV52865.1| 960|Anopheles gambiae male-specific transcription factor FRU-MA protein. Length = 960 Score = 22.2 bits (45), Expect = 6.8 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = +2 Query: 188 RV*NTAPPHPIPTHTYRGIK 247 +V + AP HP+ H GIK Sbjct: 399 KVSSPAPVHPLAGHPLSGIK 418 >AY785360-1|AAV52864.1| 759|Anopheles gambiae male-specific transcription factor FRU-MB protein. Length = 759 Score = 22.2 bits (45), Expect = 6.8 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = +2 Query: 188 RV*NTAPPHPIPTHTYRGIK 247 +V + AP HP+ H GIK Sbjct: 399 KVSSPAPVHPLAGHPLSGIK 418 >AY725820-1|AAU50568.1| 593|Anopheles gambiae fruitless female-specific zinc-fingerC isoform protein. Length = 593 Score = 22.2 bits (45), Expect = 6.8 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = +2 Query: 188 RV*NTAPPHPIPTHTYRGIK 247 +V + AP HP+ H GIK Sbjct: 351 KVSSPAPVHPLAGHPLSGIK 370 >AY725819-1|AAU50567.1| 569|Anopheles gambiae fruitless male-specific zinc-fingerC isoform protein. Length = 569 Score = 22.2 bits (45), Expect = 6.8 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = +2 Query: 188 RV*NTAPPHPIPTHTYRGIK 247 +V + AP HP+ H GIK Sbjct: 359 KVSSPAPVHPLAGHPLSGIK 378 >AY324315-1|AAQ89700.1| 153|Anopheles gambiae insulin-like peptide 7 precursor protein. Length = 153 Score = 22.2 bits (45), Expect = 6.8 Identities = 13/24 (54%), Positives = 16/24 (66%) Frame = +1 Query: 55 GRRFLLRVVSDGRIELVLLVPVSL 126 G R LL VVS G L+LLV +S+ Sbjct: 5 GSRHLLLVVSCGAALLLLLVLLSV 28 >AY324314-1|AAQ89699.1| 153|Anopheles gambiae insulin-like peptide 7 precursor protein. Length = 153 Score = 22.2 bits (45), Expect = 6.8 Identities = 13/24 (54%), Positives = 16/24 (66%) Frame = +1 Query: 55 GRRFLLRVVSDGRIELVLLVPVSL 126 G R LL VVS G L+LLV +S+ Sbjct: 5 GSRHLLLVVSCGAALLLLLVLLSV 28 >AY324307-1|AAQ89692.1| 154|Anopheles gambiae insulin-like peptide 1 precursor protein. Length = 154 Score = 22.2 bits (45), Expect = 6.8 Identities = 13/24 (54%), Positives = 16/24 (66%) Frame = +1 Query: 55 GRRFLLRVVSDGRIELVLLVPVSL 126 G R LL VVS G L+LLV +S+ Sbjct: 5 GSRHLLLVVSCGTALLLLLVLLSV 28 >DQ004399-1|AAY21238.1| 847|Anopheles gambiae lysozyme c-6 protein. Length = 847 Score = 21.8 bits (44), Expect = 9.0 Identities = 8/21 (38%), Positives = 13/21 (61%) Frame = -1 Query: 101 SSILPSETTLRRNLLPPNTKP 39 ++I+P+ T RR + PP P Sbjct: 632 NAIVPTPPTTRRPIAPPKNFP 652 >AY578800-1|AAT07305.1| 379|Anopheles gambiae decapentaplegic protein. Length = 379 Score = 21.8 bits (44), Expect = 9.0 Identities = 9/32 (28%), Positives = 15/32 (46%) Frame = -1 Query: 149 RRPTLNHGRLTGTSSTSSILPSETTLRRNLLP 54 R+P NHG + P + RR+++P Sbjct: 179 RQPRKNHGLFVQVTGRGRGPPGHSRQRRSIVP 210 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 435,636 Number of Sequences: 2352 Number of extensions: 9535 Number of successful extensions: 20 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 18 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 20 length of database: 563,979 effective HSP length: 58 effective length of database: 427,563 effective search space used: 29929410 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -