BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV12i11r (660 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_01_0092 - 650534-650553,650638-651013,651125-651349 29 3.3 12_01_0033 - 272848-272943,274026-274169,274264-274375,274521-27... 29 4.3 11_06_0535 - 24740950-24741089,24741358-24741451,24741535-247416... 29 4.3 >02_01_0092 - 650534-650553,650638-651013,651125-651349 Length = 206 Score = 29.1 bits (62), Expect = 3.3 Identities = 13/42 (30%), Positives = 21/42 (50%) Frame = +3 Query: 339 SNDNRGGHDWLSDSTTVGKREVDDFGSEDRLLYGVESDEDFV 464 S+ + D +S + G + DD+G RL + +D DFV Sbjct: 161 SSGSAADDDRMSSMSCSGSPDDDDYGGSSRLCQWITTDSDFV 202 >12_01_0033 - 272848-272943,274026-274169,274264-274375,274521-274702, 274781-274912,275038-276330,279841-280545,280649-280695, 280787-280865 Length = 929 Score = 28.7 bits (61), Expect = 4.3 Identities = 15/40 (37%), Positives = 22/40 (55%) Frame = +3 Query: 363 DWLSDSTTVGKREVDDFGSEDRLLYGVESDEDFVQMLEKE 482 DWLSDS VGK ++ + + V ++ D +Q EKE Sbjct: 840 DWLSDSGVVGKIKLASVQLAKKYMNRVATELDALQGTEKE 879 >11_06_0535 - 24740950-24741089,24741358-24741451,24741535-24741690, 24741782-24741841,24741930-24742142,24742423-24742492, 24746129-24746463,24747616-24747647,24747749-24747776 Length = 375 Score = 28.7 bits (61), Expect = 4.3 Identities = 16/38 (42%), Positives = 24/38 (63%) Frame = +3 Query: 429 LLYGVESDEDFVQMLEKESSGGWVCAGAVDSVQNGLQL 542 LL+GVE D DF + L KE S V G+V ++N +++ Sbjct: 305 LLFGVEDDMDFARELIKEES-VLVLPGSVIGLKNWIRI 341 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,773,213 Number of Sequences: 37544 Number of extensions: 257677 Number of successful extensions: 645 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 613 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 643 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1655832080 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -