BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV12i08r (765 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_06_0048 - 19614636-19616076,19618621-19618992,19619057-19619451 28 7.1 10_08_0931 - 21647562-21649037 28 7.1 >11_06_0048 - 19614636-19616076,19618621-19618992,19619057-19619451 Length = 735 Score = 28.3 bits (60), Expect = 7.1 Identities = 12/41 (29%), Positives = 22/41 (53%) Frame = +2 Query: 269 LGSFRILDHILVNNDKKFLQ*DMNYVKNYKFQCLTAFFCWT 391 LGS L + + +K + D + +Y+F+CL+ F W+ Sbjct: 615 LGSIPSLSRLYLGVEKPTVDRDERLIISYRFKCLSLFEYWS 655 >10_08_0931 - 21647562-21649037 Length = 491 Score = 28.3 bits (60), Expect = 7.1 Identities = 15/45 (33%), Positives = 29/45 (64%) Frame = -2 Query: 389 SNKKKQLNIEIYSSSHNSYPIAKISCRYLRECGQEFESCPKKKPN 255 S+ K +++I+ SSS + YP+AK S R +R + +S +++P+ Sbjct: 326 SSAKPRISIDSSSSSSSYYPVAK-SVRTIRGGRESLQSQSQEQPD 369 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,369,827 Number of Sequences: 37544 Number of extensions: 278879 Number of successful extensions: 573 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 563 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 573 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 2051430072 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -