BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV12i08f (581 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC9E9.02 |||dubious|Schizosaccharomyces pombe|chr 1|||Manual 29 0.37 SPCC306.09c |cap1|cap|adenylyl cyclase-associated protein Cap1|S... 27 1.5 >SPAC9E9.02 |||dubious|Schizosaccharomyces pombe|chr 1|||Manual Length = 98 Score = 29.5 bits (63), Expect = 0.37 Identities = 13/34 (38%), Positives = 18/34 (52%) Frame = +3 Query: 204 KKKHSSVLTKLILLQKNPYFYLYECSQCFYFLFL 305 KK +SVL K F+LY +C Y+LF+ Sbjct: 63 KKIKNSVLLKTSFDSNETIFFLYSLHRCVYYLFI 96 >SPCC306.09c |cap1|cap|adenylyl cyclase-associated protein Cap1|Schizosaccharomyces pombe|chr 3|||Manual Length = 551 Score = 27.5 bits (58), Expect = 1.5 Identities = 10/28 (35%), Positives = 19/28 (67%) Frame = -1 Query: 143 WNRSYLYIVTSLLRHTRHTFSSGISVNT 60 W RSYL ++T L+ + + F +G++ +T Sbjct: 246 WVRSYLTLLTELITYVKTHFKTGLTWST 273 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,267,106 Number of Sequences: 5004 Number of extensions: 44110 Number of successful extensions: 86 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 86 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 86 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 250133048 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -