BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV12i04r (650 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_8553| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.9 SB_41955| Best HMM Match : RVT_1 (HMM E-Value=5.3e-15) 29 3.3 SB_34263| Best HMM Match : MORN (HMM E-Value=0.067) 29 4.3 SB_58952| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 >SB_8553| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 982 Score = 29.9 bits (64), Expect = 1.9 Identities = 12/37 (32%), Positives = 22/37 (59%) Frame = -1 Query: 113 VIDFENLRQSDHTISSIVVLVELSIIGYVVFVFICYG 3 +I+ R T ++++V +S+I V+F+FI YG Sbjct: 381 MIEATRPRNDGVTKKIVIIVVVVSVIALVIFIFIAYG 417 >SB_41955| Best HMM Match : RVT_1 (HMM E-Value=5.3e-15) Length = 962 Score = 29.1 bits (62), Expect = 3.3 Identities = 15/36 (41%), Positives = 24/36 (66%) Frame = -1 Query: 575 SCLHVLLLRSRICLNFKRHPMSERLL*ITRKICLSN 468 +CLH L+R RI L + + S+RLL T+K+ L++ Sbjct: 387 TCLHDSLIRDRIVLGIRDNDTSKRLL-QTKKLSLAH 421 >SB_34263| Best HMM Match : MORN (HMM E-Value=0.067) Length = 757 Score = 28.7 bits (61), Expect = 4.3 Identities = 10/27 (37%), Positives = 17/27 (62%) Frame = -1 Query: 452 NWFLFFIL*IMNKLIRCKFCCVVIGCV 372 NWFLF I + ++L KF +++ C+ Sbjct: 507 NWFLFVIESVRDRLFTTKFTTIILECL 533 >SB_58952| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 338 Score = 28.3 bits (60), Expect = 5.7 Identities = 10/34 (29%), Positives = 20/34 (58%) Frame = +1 Query: 145 RFDNKFQQNYKNGSRSVITKSGLTNKNGGFFIDV 246 +++ + Y++G ++ KS L+N FF+DV Sbjct: 187 KYNASYNLEYRHGPVELVNKSILSNSRTAFFVDV 220 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,532,923 Number of Sequences: 59808 Number of extensions: 290837 Number of successful extensions: 498 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 466 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 498 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1657237625 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -