BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV12i04r (650 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF022977-3|AAB88609.1| 554|Caenorhabditis elegans Hypothetical ... 29 3.8 U55370-1|AAA97993.3| 313|Caenorhabditis elegans Serpentine rece... 28 5.0 >AF022977-3|AAB88609.1| 554|Caenorhabditis elegans Hypothetical protein ZK994.1 protein. Length = 554 Score = 28.7 bits (61), Expect = 3.8 Identities = 15/38 (39%), Positives = 20/38 (52%), Gaps = 2/38 (5%) Frame = +1 Query: 148 FDNKFQQNYKNGSRSVITKSGLTNKNGGFFID--VTNF 255 + NK+ KN S V+ SGL +G FF D + NF Sbjct: 109 YSNKYCIENKNCSVMVVVPSGLVQSHGSFFNDTIINNF 146 >U55370-1|AAA97993.3| 313|Caenorhabditis elegans Serpentine receptor, class x protein77 protein. Length = 313 Score = 28.3 bits (60), Expect = 5.0 Identities = 9/24 (37%), Positives = 16/24 (66%) Frame = -2 Query: 223 FYWSNPILL*RFYCHFYSFVEIYY 152 FYWS +L+ F+ + ++F +YY Sbjct: 182 FYWSLGLLIFPFFVNIFTFARLYY 205 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,044,310 Number of Sequences: 27780 Number of extensions: 250050 Number of successful extensions: 565 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 547 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 565 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1444744186 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -