BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV12i04r (650 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ435328-1|ABD92643.1| 143|Apis mellifera OBP11 protein. 24 1.1 AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. 24 1.5 DQ011228-1|AAY63897.1| 486|Apis mellifera Amt-2-like protein pr... 23 2.6 DQ325132-1|ABD14146.1| 189|Apis mellifera complementary sex det... 21 7.8 DQ325131-1|ABD14145.1| 189|Apis mellifera complementary sex det... 21 7.8 >DQ435328-1|ABD92643.1| 143|Apis mellifera OBP11 protein. Length = 143 Score = 24.2 bits (50), Expect = 1.1 Identities = 13/45 (28%), Positives = 24/45 (53%) Frame = +1 Query: 43 LSSTKTTIEDIV*SDCRRFSKSITITNIFYILLGRFDNKFQQNYK 177 + TKTTIED+ ++ F + + F +L +F+ ++N K Sbjct: 44 IGETKTTIEDVEATEYGEFPEDEKLKCYFNCVLEKFNVMDKKNGK 88 >AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. Length = 996 Score = 23.8 bits (49), Expect = 1.5 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = +3 Query: 348 SLRCYLLLDTTNNNTAEFTSYQF 416 SL +LLDTT E+T Y F Sbjct: 11 SLVSVVLLDTTQEEKLEWTKYPF 33 >DQ011228-1|AAY63897.1| 486|Apis mellifera Amt-2-like protein protein. Length = 486 Score = 23.0 bits (47), Expect = 2.6 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = -1 Query: 74 ISSIVVLVELSIIGYVVFVFICY 6 I IVV+ +SII Y+ F+ + Y Sbjct: 402 ICLIVVIALVSIIMYIAFIILQY 424 >DQ325132-1|ABD14146.1| 189|Apis mellifera complementary sex determiner protein. Length = 189 Score = 21.4 bits (43), Expect = 7.8 Identities = 9/28 (32%), Positives = 15/28 (53%) Frame = +3 Query: 27 NITYNTKFN*NYD*RYCMIRLSKILKID 110 N YN +N NY+ Y + + I+ I+ Sbjct: 98 NNNYNNNYNNNYNNNYKKLYKNYIINIE 125 >DQ325131-1|ABD14145.1| 189|Apis mellifera complementary sex determiner protein. Length = 189 Score = 21.4 bits (43), Expect = 7.8 Identities = 9/28 (32%), Positives = 15/28 (53%) Frame = +3 Query: 27 NITYNTKFN*NYD*RYCMIRLSKILKID 110 N YN +N NY+ Y + + I+ I+ Sbjct: 98 NNNYNNNYNNNYNNNYKKLYKNYIINIE 125 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 163,137 Number of Sequences: 438 Number of extensions: 3353 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19682733 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -