BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV12i01r (563 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 23 1.8 AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B prot... 21 9.6 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 23.0 bits (47), Expect = 1.8 Identities = 12/35 (34%), Positives = 16/35 (45%) Frame = +3 Query: 459 LHFTNRSKIGKKTFSNN*RIQHKGHTPSSTSWP*P 563 LH+ KI S + GH PS++SW P Sbjct: 1135 LHWNKERKICDWPKSAKCEEKKPGHKPSTSSWQKP 1169 >AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B protein. Length = 351 Score = 20.6 bits (41), Expect = 9.6 Identities = 11/30 (36%), Positives = 15/30 (50%) Frame = -1 Query: 305 RQKPKETSRNAKKEKCQ*KDWFIPTRKKTQ 216 +QK E +RN + Q K WF R K + Sbjct: 270 KQKRWELARNLNLTERQVKIWFQNRRMKNK 299 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 112,133 Number of Sequences: 336 Number of extensions: 2143 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 13890653 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -