BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV12i01r (563 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_48886| Best HMM Match : 4F5 (HMM E-Value=0.037) 42 3e-04 SB_12467| Best HMM Match : Ank (HMM E-Value=3.2e-10) 28 4.6 SB_2367| Best HMM Match : HEAT (HMM E-Value=1.1e-07) 28 6.1 SB_48777| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.1 SB_15683| Best HMM Match : Y_phosphatase (HMM E-Value=0) 27 8.0 >SB_48886| Best HMM Match : 4F5 (HMM E-Value=0.037) Length = 476 Score = 41.9 bits (94), Expect = 3e-04 Identities = 21/42 (50%), Positives = 30/42 (71%) Frame = -2 Query: 340 RMTRGNQRDLARAKNQKKQVEMQKKKNASEKTGLSLQERKHR 215 R++ GNQR+LARAKNQKKQ + ++ + K G +L +RK R Sbjct: 214 RVSGGNQRELARAKNQKKQTGKKASEHDANK-GQNLTDRKQR 254 >SB_12467| Best HMM Match : Ank (HMM E-Value=3.2e-10) Length = 444 Score = 28.3 bits (60), Expect = 4.6 Identities = 12/29 (41%), Positives = 19/29 (65%) Frame = -2 Query: 307 RAKNQKKQVEMQKKKNASEKTGLSLQERK 221 +AKN+KKQ E++KKK + + + RK Sbjct: 357 QAKNEKKQREIEKKKEEEARQQMEREMRK 385 >SB_2367| Best HMM Match : HEAT (HMM E-Value=1.1e-07) Length = 653 Score = 27.9 bits (59), Expect = 6.1 Identities = 13/41 (31%), Positives = 22/41 (53%) Frame = -2 Query: 334 TRGNQRDLARAKNQKKQVEMQKKKNASEKTGLSLQERKHRD 212 T N ++ R KN+K+ V+ Q+ KNA + ++ K D Sbjct: 169 TEPNSKNQTRGKNKKESVQEQESKNAVTVSNATVTGTKKLD 209 >SB_48777| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 170 Score = 27.9 bits (59), Expect = 6.1 Identities = 15/43 (34%), Positives = 24/43 (55%) Frame = -2 Query: 340 RMTRGNQRDLARAKNQKKQVEMQKKKNASEKTGLSLQERKHRD 212 R QR+LAR KN ++ E Q A K L L+++K+++ Sbjct: 6 RQLNRTQRELARDKNALERQEKQLAATALAKQLLQLRKQKNKN 48 >SB_15683| Best HMM Match : Y_phosphatase (HMM E-Value=0) Length = 753 Score = 27.5 bits (58), Expect = 8.0 Identities = 14/44 (31%), Positives = 21/44 (47%) Frame = +1 Query: 349 NFTKEKFTFVATYNYFKNTVKAGRYASPVET*DNAPPSISPIGV 480 + TK TF+ + T +G P++T N PPS+S V Sbjct: 51 HLTKYLHTFIRSVQAVSGTAVSGVDFEPLQTTINIPPSVSTYNV 94 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,057,854 Number of Sequences: 59808 Number of extensions: 240024 Number of successful extensions: 556 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 525 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 556 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1325051197 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -