BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV12i01f (607 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC1705.02 |||human 4F5S homolog|Schizosaccharomyces pombe|chr ... 36 0.006 SPAC6F6.01 |||VIC sodium channel |Schizosaccharomyces pombe|chr ... 27 2.8 SPAC1142.01 ||SPAC17G6.18|DUF654 family protein|Schizosaccharomy... 27 2.8 SPBC543.05c |||inorganic anion exchanger |Schizosaccharomyces po... 26 3.7 SPBPB2B2.02 |mug180||esterase/lipase |Schizosaccharomyces pombe|... 25 8.6 SPAC3G6.07 |||sequence orphan|Schizosaccharomyces pombe|chr 1|||... 25 8.6 >SPAC1705.02 |||human 4F5S homolog|Schizosaccharomyces pombe|chr 1|||Manual Length = 63 Score = 35.5 bits (78), Expect = 0.006 Identities = 17/31 (54%), Positives = 22/31 (70%) Frame = +2 Query: 227 MTRGNQRDLARAKNQKKQVEMQKKKNASEKT 319 M+RGNQRD+ RA+N KK + KKK A + T Sbjct: 1 MSRGNQRDVDRARNLKKS-QASKKKQAGDPT 30 >SPAC6F6.01 |||VIC sodium channel |Schizosaccharomyces pombe|chr 1|||Manual Length = 1854 Score = 26.6 bits (56), Expect = 2.8 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = +1 Query: 25 RCVAFVLYTLIIAKSFFSNF 84 RC+ + YT IAK FSNF Sbjct: 621 RCILLIPYTRKIAKLLFSNF 640 >SPAC1142.01 ||SPAC17G6.18|DUF654 family protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 667 Score = 26.6 bits (56), Expect = 2.8 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = +2 Query: 257 RAKNQKKQVEMQKKKNASEKTGLSLQ 334 +AKN+KK+ + QKKK + K L Q Sbjct: 95 KAKNKKKKKKQQKKKKVTGKRDLDNQ 120 >SPBC543.05c |||inorganic anion exchanger |Schizosaccharomyces pombe|chr 2|||Manual Length = 517 Score = 26.2 bits (55), Expect = 3.7 Identities = 13/38 (34%), Positives = 21/38 (55%) Frame = +1 Query: 46 YTLIIAKSFFSNFTPIGEMEGGALS*VSTGLAYRPAFT 159 Y L+ + FFS F IG+M +L+ + T A+ P + Sbjct: 222 YGLVASIIFFSGFQHIGKMREVSLAKLPTTKAFEPTLS 259 >SPBPB2B2.02 |mug180||esterase/lipase |Schizosaccharomyces pombe|chr 2|||Manual Length = 381 Score = 25.0 bits (52), Expect = 8.6 Identities = 14/37 (37%), Positives = 21/37 (56%) Frame = +1 Query: 7 WPAG*RRCVAFVLYTLIIAKSFFSNFTPIGEMEGGAL 117 +P R C+ +Y ++I+K F N T +GE GG L Sbjct: 172 YPKQVRECLN--VYQVLISKGF-RNITVLGESAGGTL 205 >SPAC3G6.07 |||sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 125 Score = 25.0 bits (52), Expect = 8.6 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = -3 Query: 233 ESF*LDNFTKEKFTFVATYNYFKNTVK 153 ESF D+F K+T V Y +++ VK Sbjct: 90 ESFVGDDFVMPKYTLVLPYRVYRDHVK 116 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,112,119 Number of Sequences: 5004 Number of extensions: 37137 Number of successful extensions: 98 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 98 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 98 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 266270664 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -