BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV12h24r (622 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_03_1436 - 26543846-26546806 32 0.32 10_08_1024 + 22371260-22371481,22371514-22372188,22372291-223732... 29 2.3 04_04_0446 - 25288154-25288863,25288949-25289135,25289331-25291061 29 2.3 02_01_0041 + 279583-281622,281724-282047,282315-282443,282526-28... 29 3.9 07_01_0755 - 5806614-5806939,5807039-5809415 28 6.9 >07_03_1436 - 26543846-26546806 Length = 986 Score = 32.3 bits (70), Expect = 0.32 Identities = 21/56 (37%), Positives = 24/56 (42%), Gaps = 4/56 (7%) Frame = -1 Query: 358 ITNEQCLTHYPNSRVIQKQTLC----AAYYNDTAQSSCQGDSGGPLTIVDEDGQPT 203 I N QC H+PNS + K A Y TA+ GD G DED PT Sbjct: 659 IMNSQC-PHHPNSNHVAKDCFVYKQFAEQYAKTARKPSDGDQGTSKKKDDEDDAPT 713 >10_08_1024 + 22371260-22371481,22371514-22372188,22372291-22373236, 22389377-22389552 Length = 672 Score = 29.5 bits (63), Expect = 2.3 Identities = 20/56 (35%), Positives = 23/56 (41%), Gaps = 4/56 (7%) Frame = -1 Query: 358 ITNEQCLTHYPNSRVIQKQTLC----AAYYNDTAQSSCQGDSGGPLTIVDEDGQPT 203 I N QC H+PNS + K A Y A+ GD G DED PT Sbjct: 443 IMNSQC-PHHPNSNHMAKDCFVYKQFAEQYVKNARKPADGDQGTSKKKDDEDDAPT 497 >04_04_0446 - 25288154-25288863,25288949-25289135,25289331-25291061 Length = 875 Score = 29.5 bits (63), Expect = 2.3 Identities = 21/78 (26%), Positives = 33/78 (42%), Gaps = 6/78 (7%) Frame = -1 Query: 334 HYPNSRVIQKQTLCAAYYNDTAQSSCQGDSGGPLTIVDEDGQPTMVGVVSFGHRDGC--- 164 H P SR + ++L ++ Y++ SG + +DE G P+ VS R Sbjct: 291 HMPESRHRRDESLISSTYSNGYGGDESSFSGSEVDYIDEGGSPSDSDAVSPMSRHSWDYI 350 Query: 163 ---NSPHPSAYVRPGHYH 119 NSPH ++ H H Sbjct: 351 RRHNSPHSASTFSRAHSH 368 >02_01_0041 + 279583-281622,281724-282047,282315-282443,282526-282648, 282768-282923,283224-283349,283426-283560,283815-283942, 284037-284148,284233-284547,284655-284771,284871-285166, 285252-285783,287980-288082,288808-288881,288965-289062, 289340-289380,289977-290032,290170-290244,290377-290469, 290602-290850,290930-291002,291681-291766,291853-291938, 292067-292142,292280-292347,292430-292496,292570-292665, 292741-292843,293214-293309,293396-293466 Length = 2047 Score = 28.7 bits (61), Expect = 3.9 Identities = 29/95 (30%), Positives = 41/95 (43%), Gaps = 1/95 (1%) Frame = -1 Query: 313 IQKQTLCAAYYNDTAQSSCQGDSGGPLTIVDEDGQPTMVGVVSFGHRDGCNSPHPSAYVR 134 IQ+Q L A+Y ++ QSS + TI +E T G VS + G S +P V Sbjct: 230 IQQQQLAASYMHNPTQSSLE-------TIAEEG---TTTGSVSTWGQGG-TSEYPPNMVF 278 Query: 133 PGHYHDWFYEVTGINFDWSS-EDLKPIVLAEAQDD 32 Y W+++ W S E + V A A D Sbjct: 279 YAEYPGWYFDTN--TQQWQSLESYQQAVTASAVQD 311 >07_01_0755 - 5806614-5806939,5807039-5809415 Length = 900 Score = 27.9 bits (59), Expect = 6.9 Identities = 12/32 (37%), Positives = 20/32 (62%) Frame = -1 Query: 595 HPRYIEILGGVQTDDIALVKLNHHIPYSRYIQ 500 HP + +G V +D+AL+ L+HH+P +Q Sbjct: 673 HPNLVRPIGYVIYEDVALL-LHHHMPNGTLLQ 703 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,191,429 Number of Sequences: 37544 Number of extensions: 372836 Number of successful extensions: 1127 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1100 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1127 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1502076244 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -