BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV12h24f (573 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g16610.2 68414.m01990 arginine/serine-rich protein, putative ... 31 0.41 At1g16610.1 68414.m01989 arginine/serine-rich protein, putative ... 31 0.41 At5g36200.1 68418.m04364 F-box family protein contains Pfam PF00... 29 2.2 At5g12960.1 68418.m01486 expressed protein 28 3.8 At3g10670.1 68416.m01283 ABC transporter family protein similar ... 28 5.1 At1g49890.1 68414.m05593 expressed protein contains Pfam domain,... 28 5.1 At2g36930.1 68415.m04529 zinc finger (C2H2 type) family protein ... 27 6.7 At2g25250.1 68415.m03021 expressed protein 27 6.7 At2g43255.1 68415.m05376 expressed protein 27 8.9 At2g40510.1 68415.m04999 40S ribosomal protein S26 (RPS26A) 27 8.9 At1g70620.2 68414.m08137 cyclin-related contains weak similarity... 27 8.9 At1g70620.1 68414.m08138 cyclin-related contains weak similarity... 27 8.9 >At1g16610.2 68414.m01990 arginine/serine-rich protein, putative (SR45) similar to arginine/serine-rich protein GI:6601502 from [Arabidopsis thaliana] Length = 407 Score = 31.5 bits (68), Expect = 0.41 Identities = 25/60 (41%), Positives = 29/60 (48%), Gaps = 2/60 (3%) Frame = +2 Query: 92 RIRSDHRRSPKH--GPPISHRSRLACRRRSDPASDQPSYGQPRRGSQLLRRFNHSPRMGP 265 R RS R SP+ G P+ RS L RRRS P S PRR +RR + SP P Sbjct: 279 RYRSPPRGSPRRIRGSPVRRRSPLPLRRRSPPPRRLRS--PPRRSP--IRRRSRSPIRRP 334 >At1g16610.1 68414.m01989 arginine/serine-rich protein, putative (SR45) similar to arginine/serine-rich protein GI:6601502 from [Arabidopsis thaliana] Length = 414 Score = 31.5 bits (68), Expect = 0.41 Identities = 25/60 (41%), Positives = 29/60 (48%), Gaps = 2/60 (3%) Frame = +2 Query: 92 RIRSDHRRSPKH--GPPISHRSRLACRRRSDPASDQPSYGQPRRGSQLLRRFNHSPRMGP 265 R RS R SP+ G P+ RS L RRRS P S PRR +RR + SP P Sbjct: 286 RYRSPPRGSPRRIRGSPVRRRSPLPLRRRSPPPRRLRS--PPRRSP--IRRRSRSPIRRP 341 >At5g36200.1 68418.m04364 F-box family protein contains Pfam PF00646: F-box domain; contains TIGRFAM TIGR01640: F-box protein interaction domain; similar to unknown protein (pir||T00841) Length = 471 Score = 29.1 bits (62), Expect = 2.2 Identities = 18/60 (30%), Positives = 29/60 (48%), Gaps = 2/60 (3%) Frame = +3 Query: 339 DYLVETTHKFIHPRYIEILGGVQTDDIALVKLNHHIPYSRYIQP--CRLQNSEQKNINYE 512 D ++ T+ H + +L G D I LV N H+ +R+I+P Q ++ I YE Sbjct: 103 DDILNNTYIIFHCNGLLLLLGFTDDGIKLVVTNPHLGQTRWIKPRKANYQFCDKYAIGYE 162 >At5g12960.1 68418.m01486 expressed protein Length = 865 Score = 28.3 bits (60), Expect = 3.8 Identities = 15/44 (34%), Positives = 23/44 (52%) Frame = +3 Query: 318 LTNLTRPDYLVETTHKFIHPRYIEILGGVQTDDIALVKLNHHIP 449 L ++TR + H F P ++ +L +Q DDI+ N HIP Sbjct: 305 LYSITRDSKYLFLAHLFDKPCFLGVLA-IQADDISGFHANTHIP 347 >At3g10670.1 68416.m01283 ABC transporter family protein similar to ABC transporter ATPase GB:AAC68280 [Chlamydia trachomatis] Length = 338 Score = 27.9 bits (59), Expect = 5.1 Identities = 18/57 (31%), Positives = 28/57 (49%) Frame = -3 Query: 211 GLTIRRLI*CGI*ASSAGQPATMRDWRSVFRRSSMIASDPALTGLP*TRDTVYKIPI 41 G + R++ C + A+SA P RSV +S ++S L RD V +IP+ Sbjct: 35 GTSPSRVLLCNLRANSAAAPILRTTRRSVIVSASSVSSAVDSDSLVEDRDDVGRIPL 91 >At1g49890.1 68414.m05593 expressed protein contains Pfam domain, PF04484: Family of unknown function (DUF566) Length = 659 Score = 27.9 bits (59), Expect = 5.1 Identities = 12/26 (46%), Positives = 14/26 (53%) Frame = +2 Query: 134 PISHRSRLACRRRSDPASDQPSYGQP 211 P+SHR RRRS P DQ +P Sbjct: 166 PVSHRKSTPERRRSTPVRDQRENSKP 191 >At2g36930.1 68415.m04529 zinc finger (C2H2 type) family protein contains Prosite PS00028: Zinc finger, C2H2 type, domain; weak similarity to Zinc finger protein T86 (Swiss-Prot:O00488) [Homo sapiens] Length = 198 Score = 27.5 bits (58), Expect = 6.7 Identities = 18/76 (23%), Positives = 29/76 (38%) Frame = +2 Query: 56 YCIPCSGQSG*CRIRSDHRRSPKHGPPISHRSRLACRRRSDPASDQPSYGQPRRGSQLLR 235 YC+ C +R DH ++ KH ++ A + D A G P G +L+ Sbjct: 59 YCLHCDRYFSNVSVRDDHFKTKKHKKRVNMMMGQAPHSQLD-ADLAGGMGMPDNGPKLMS 117 Query: 236 RFNHSPRMGPDCGPLP 283 + P+ LP Sbjct: 118 NLVFTELRKPETEDLP 133 >At2g25250.1 68415.m03021 expressed protein Length = 155 Score = 27.5 bits (58), Expect = 6.7 Identities = 11/32 (34%), Positives = 15/32 (46%) Frame = +2 Query: 116 SPKHGPPISHRSRLACRRRSDPASDQPSYGQP 211 S PP+ H+ + RRR P+S Q P Sbjct: 17 STNTSPPLRHKKPITNRRRRSPSSHQSQISHP 48 >At2g43255.1 68415.m05376 expressed protein Length = 214 Score = 27.1 bits (57), Expect = 8.9 Identities = 12/37 (32%), Positives = 22/37 (59%) Frame = -2 Query: 179 DLSVFCRPTGYDARLAVRVSEIFDDRF*SGINRIALN 69 D+S+F P Y A A+ S++F+ S +N+I ++ Sbjct: 142 DISIFDHPISYVAASALTGSQVFNIHIVSYVNKIIIS 178 >At2g40510.1 68415.m04999 40S ribosomal protein S26 (RPS26A) Length = 133 Score = 27.1 bits (57), Expect = 8.9 Identities = 16/47 (34%), Positives = 21/47 (44%) Frame = +2 Query: 56 YCIPCSGQSG*CRIRSDHRRSPKHGPPISHRSRLACRRRSDPASDQP 196 YC+ C+ S R+RS R + PP R A R+ P QP Sbjct: 73 YCVSCAIHSHVVRVRSRTNRRVRTPPP-----RFARRKEDTPKPGQP 114 >At1g70620.2 68414.m08137 cyclin-related contains weak similarity to Swiss-Prot:P35662 cylicin I (Multiple-band polypeptide I) [Bos taurus] Length = 884 Score = 27.1 bits (57), Expect = 8.9 Identities = 21/55 (38%), Positives = 28/55 (50%) Frame = +2 Query: 98 RSDHRRSPKHGPPISHRSRLACRRRSDPASDQPSYGQPRRGSQLLRRFNHSPRMG 262 +S RR P+ RSR R+RS P+SD+ S R+ S +R N SP G Sbjct: 832 KSRSRRRSVSPSPV--RSR---RKRSSPSSDESSDDSKRKSSS--KRKNRSPSPG 879 >At1g70620.1 68414.m08138 cyclin-related contains weak similarity to Swiss-Prot:P35662 cylicin I (Multiple-band polypeptide I) [Bos taurus] Length = 897 Score = 27.1 bits (57), Expect = 8.9 Identities = 21/55 (38%), Positives = 28/55 (50%) Frame = +2 Query: 98 RSDHRRSPKHGPPISHRSRLACRRRSDPASDQPSYGQPRRGSQLLRRFNHSPRMG 262 +S RR P+ RSR R+RS P+SD+ S R+ S +R N SP G Sbjct: 802 KSRSRRRSVSPSPV--RSR---RKRSSPSSDESSDDSKRKSSS--KRKNRSPSPG 849 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,879,110 Number of Sequences: 28952 Number of extensions: 262861 Number of successful extensions: 657 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 643 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 655 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1112061928 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -