BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV12h21f (527 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY127579-1|AAN02286.1| 405|Apis mellifera venom protease precur... 36 3e-04 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 25 0.48 AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamat... 25 0.63 AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamat... 23 2.6 DQ257416-1|ABB81847.1| 552|Apis mellifera yellow-h protein. 22 4.5 DQ011228-1|AAY63897.1| 486|Apis mellifera Amt-2-like protein pr... 22 4.5 DQ325089-1|ABD14103.1| 185|Apis mellifera complementary sex det... 21 5.9 DQ325088-1|ABD14102.1| 185|Apis mellifera complementary sex det... 21 5.9 AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 21 7.8 AJ276511-1|CAC06383.1| 352|Apis mellifera Antennapedia protein ... 21 7.8 AB022908-1|BAA86909.1| 493|Apis mellifera amylase protein. 21 7.8 >AY127579-1|AAN02286.1| 405|Apis mellifera venom protease precursor protein. Length = 405 Score = 35.9 bits (79), Expect = 3e-04 Identities = 18/48 (37%), Positives = 27/48 (56%) Frame = +1 Query: 181 TRIVGGSAANAGAHPHLAGLVIALTNGRTSICGASLLTNTRSVTAAHC 324 +RIVGG+ P +AG+ G ICGA++++ +TAAHC Sbjct: 159 SRIVGGTNTGINEFPMMAGIKRTYEPGM--ICGATIISKRYVLTAAHC 204 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 25.0 bits (52), Expect = 0.48 Identities = 11/32 (34%), Positives = 19/32 (59%) Frame = -2 Query: 259 HSSVRSQVQQDGGEHQRWRQNHPQSWYRRSQR 164 HSS ++Q QQ + Q+ +Q PQ ++ Q+ Sbjct: 1495 HSSQKTQQQQPQQQQQQQQQQQPQQQSQQPQQ 1526 Score = 21.8 bits (44), Expect = 4.5 Identities = 12/27 (44%), Positives = 15/27 (55%), Gaps = 3/27 (11%) Frame = -3 Query: 402 PGAS---GEDVSCAKSEGELTSLGSPG 331 PG S GE S A ++G T+ SPG Sbjct: 893 PGCSSKNGEPTSAAFAQGFATAASSPG 919 >AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamate receptor 1 protein. Length = 843 Score = 24.6 bits (51), Expect = 0.63 Identities = 6/14 (42%), Positives = 10/14 (71%) Frame = +3 Query: 231 CWTCDRTDEWQNFH 272 CW CD+ +E++ H Sbjct: 467 CWVCDQCEEYEYVH 480 >AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamate receptor protein. Length = 933 Score = 22.6 bits (46), Expect = 2.6 Identities = 5/11 (45%), Positives = 9/11 (81%) Frame = +3 Query: 231 CWTCDRTDEWQ 263 CW CD+ +E++ Sbjct: 557 CWVCDQCEEYE 567 >DQ257416-1|ABB81847.1| 552|Apis mellifera yellow-h protein. Length = 552 Score = 21.8 bits (44), Expect = 4.5 Identities = 8/21 (38%), Positives = 12/21 (57%) Frame = +1 Query: 322 CWRTRRAQARQFTLALGTANI 384 CW TR+ Q +GT+N+ Sbjct: 459 CWDTRKEYIPQNLGVIGTSNL 479 >DQ011228-1|AAY63897.1| 486|Apis mellifera Amt-2-like protein protein. Length = 486 Score = 21.8 bits (44), Expect = 4.5 Identities = 9/25 (36%), Positives = 14/25 (56%) Frame = -3 Query: 180 TVEVSGFLGASKTLGPGDTDLDVVV 106 T +V G +GA +G D D D ++ Sbjct: 108 TGDVHGVIGAGHWIGDHDVDKDELI 132 >DQ325089-1|ABD14103.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 21.4 bits (43), Expect = 5.9 Identities = 8/24 (33%), Positives = 15/24 (62%) Frame = +1 Query: 433 SYNMDTLHNDVAIINHNHVGFTNN 504 S + +T+HN+ N+N+ + NN Sbjct: 83 SLSNNTIHNNNYKYNYNNNNYNNN 106 >DQ325088-1|ABD14102.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 21.4 bits (43), Expect = 5.9 Identities = 8/24 (33%), Positives = 15/24 (62%) Frame = +1 Query: 433 SYNMDTLHNDVAIINHNHVGFTNN 504 S + +T+HN+ N+N+ + NN Sbjct: 83 SLSNNTIHNNNYKYNYNNNNYNNN 106 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 21.0 bits (42), Expect = 7.8 Identities = 9/24 (37%), Positives = 12/24 (50%) Frame = +2 Query: 353 SSPSLLAQLTSSPEAPGSPPPMSR 424 S PS + ++ EAP PP R Sbjct: 961 SDPSDTVTIITAEEAPSGPPTSIR 984 >AJ276511-1|CAC06383.1| 352|Apis mellifera Antennapedia protein protein. Length = 352 Score = 21.0 bits (42), Expect = 7.8 Identities = 7/12 (58%), Positives = 8/12 (66%) Frame = +3 Query: 492 LHQQHPAHQPSQ 527 +H QHP QP Q Sbjct: 172 MHTQHPHMQPQQ 183 >AB022908-1|BAA86909.1| 493|Apis mellifera amylase protein. Length = 493 Score = 21.0 bits (42), Expect = 7.8 Identities = 5/8 (62%), Positives = 5/8 (62%) Frame = +3 Query: 192 GWFCRQRW 215 GW C RW Sbjct: 377 GWICEHRW 384 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 123,945 Number of Sequences: 438 Number of extensions: 2295 Number of successful extensions: 13 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 14845611 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -