BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV12h19r (695 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase ... 25 0.69 DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase ... 25 0.69 AF069739-1|AAC63272.2| 690|Apis mellifera translation initiatio... 23 2.1 AB072429-1|BAB83990.1| 388|Apis mellifera IP3phosphatase protein. 22 6.4 >DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase isoform B protein. Length = 931 Score = 25.0 bits (52), Expect = 0.69 Identities = 14/35 (40%), Positives = 17/35 (48%) Frame = +2 Query: 35 DVKMNNFILII*NTPVTIDYGHCAFFFSNLQSIKG 139 DVK+ N +L I N D+G C L SI G Sbjct: 722 DVKLKNVLLDIENRAKLTDFGFCITEVMMLGSIVG 756 >DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase isoform A protein. Length = 969 Score = 25.0 bits (52), Expect = 0.69 Identities = 14/35 (40%), Positives = 17/35 (48%) Frame = +2 Query: 35 DVKMNNFILII*NTPVTIDYGHCAFFFSNLQSIKG 139 DVK+ N +L I N D+G C L SI G Sbjct: 760 DVKLKNVLLDIENRAKLTDFGFCITEVMMLGSIVG 794 >AF069739-1|AAC63272.2| 690|Apis mellifera translation initiation factor 2 protein. Length = 690 Score = 23.4 bits (48), Expect = 2.1 Identities = 11/52 (21%), Positives = 26/52 (50%) Frame = -1 Query: 263 NFIDDQGNPVHNPKMSMFPYILV*CKIINI*EHLINVKKNSFP*SIVDLKKK 108 + +D GNP+ K S IL ++ N+ + ++ V+ + ++ ++K Sbjct: 363 SMFNDSGNPILKAKPSEVVQILGWKELPNVGDEILEVENDKILQEVIKFRQK 414 >AB072429-1|BAB83990.1| 388|Apis mellifera IP3phosphatase protein. Length = 388 Score = 21.8 bits (44), Expect = 6.4 Identities = 5/17 (29%), Positives = 11/17 (64%) Frame = +2 Query: 185 FYIIQEYMETLTFWDYE 235 FY + E ++ + WD++ Sbjct: 103 FYFVHESLKNVLLWDFQ 119 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 185,589 Number of Sequences: 438 Number of extensions: 4034 Number of successful extensions: 7 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21317625 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -