BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV12h19f (604 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g27350.1 68414.m03331 expressed protein contains 1 transmembr... 56 1e-08 At1g27330.1 68414.m03329 expressed protein similar to EST gb|AA6... 56 1e-08 At1g31960.1 68414.m03929 hypothetical protein 29 3.1 At5g35010.1 68418.m04132 hypothetical protein similar to At3g243... 28 4.1 At5g52460.1 68418.m06509 F-box family protein contains F-box dom... 27 9.6 At3g28860.1 68416.m03602 multidrug resistance P-glycoprotein, pu... 27 9.6 >At1g27350.1 68414.m03331 expressed protein contains 1 transmembrane domain; similar to ribosome associated membrane protein RAMP4 GI:4585827 [Rattus norvegicus]; similar to ESTs gb|T20610 and gb|AA586199 Length = 68 Score = 56.4 bits (130), Expect = 1e-08 Identities = 26/45 (57%), Positives = 33/45 (73%) Frame = +3 Query: 144 KNITMRGNVPKTTKEKEDQYPVAPWLLALFIFVVCGSAVFQIIQS 278 KNI RG VP+TT +K YPV P LL F+FVV GS++FQII++ Sbjct: 17 KNILKRGFVPETTTKKGKDYPVGPILLGFFVFVVIGSSLFQIIRT 61 >At1g27330.1 68414.m03329 expressed protein similar to EST gb|AA650671 and gb|T20610 Length = 68 Score = 56.4 bits (130), Expect = 1e-08 Identities = 26/45 (57%), Positives = 33/45 (73%) Frame = +3 Query: 144 KNITMRGNVPKTTKEKEDQYPVAPWLLALFIFVVCGSAVFQIIQS 278 KNI RG VP+TT +K YPV P LL F+FVV GS++FQII++ Sbjct: 17 KNILKRGFVPETTTKKGKDYPVGPILLGFFVFVVIGSSLFQIIRT 61 >At1g31960.1 68414.m03929 hypothetical protein Length = 173 Score = 28.7 bits (61), Expect = 3.1 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = -2 Query: 480 NPVSVKETSSHDCTVKGTNGRLRKHSL 400 NP S++ D VKG+NG +R HS+ Sbjct: 105 NPTSIRRKLFDDAGVKGSNGVVRFHSV 131 >At5g35010.1 68418.m04132 hypothetical protein similar to At3g24380, At5g36840, At3g42740, At4g05290, At2g14770, At3g43390, At2g05560, At4g08880, At1g34730, At1g27790 Length = 230 Score = 28.3 bits (60), Expect = 4.1 Identities = 16/44 (36%), Positives = 23/44 (52%) Frame = +1 Query: 400 ERVFSEAAISTFNCAIVA*CLFHTYRVKTGRRYIRLLGTLRYRL 531 ER+ A +TF CAI+ C + + G Y+RL G+ Y L Sbjct: 115 ERIAPRNAAATFTCAILYICAGNAH---MGGVYLRLFGSNHYAL 155 >At5g52460.1 68418.m06509 F-box family protein contains F-box domain Pfam:PF00646 Length = 369 Score = 27.1 bits (57), Expect = 9.6 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = +3 Query: 501 KVIRDVEVSVVEFSMNFCLFFNIIFKDNSS 590 K+I DV SV S+N F ++FKD +S Sbjct: 119 KIIVDVPSSVCLPSLNILRLFYVVFKDENS 148 >At3g28860.1 68416.m03602 multidrug resistance P-glycoprotein, putative similar to mdr-like P-glycoprotein GI:3849833 from [Arabidopsis thaliana]; contains Pfam profiles PF00005: ABC transporter and PF00664: ABC transporter transmembrane region; identical to cDNA MDR-like p-glycoprotein (At3g28860) GI:24324261 Length = 1252 Score = 27.1 bits (57), Expect = 9.6 Identities = 11/23 (47%), Positives = 18/23 (78%) Frame = -1 Query: 187 SLVVLGTFPLIVMFLLAISLAIR 119 SL++LGTFPL+V+ A L+++ Sbjct: 833 SLLILGTFPLLVLANFAQQLSLK 855 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,922,897 Number of Sequences: 28952 Number of extensions: 270702 Number of successful extensions: 606 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 601 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 605 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1197101088 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -