BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV12h17r (728 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g16640.1 68416.m02127 translationally controlled tumor family... 119 2e-27 At3g05540.1 68416.m00607 translationally controlled tumor family... 95 4e-20 At4g29060.1 68417.m04157 elongation factor Ts family protein sim... 34 0.084 At2g17050.1 68415.m01968 disease resistance protein (TIR-NBS-LRR... 34 0.084 At1g76380.3 68414.m08876 DNA-binding bromodomain-containing prot... 30 1.8 At1g76380.1 68414.m08874 DNA-binding bromodomain-containing prot... 30 1.8 At1g63910.1 68414.m07236 myb family transcription factor (MYB103... 29 3.2 At5g49030.1 68418.m06067 tRNA synthetase class I (I, L, M and V)... 27 9.6 At5g42270.1 68418.m05145 FtsH protease, putative similar to FtsH... 27 9.6 At1g50250.1 68414.m05634 cell division protein ftsH homolog 1, c... 27 9.6 >At3g16640.1 68416.m02127 translationally controlled tumor family protein similar to translationally controlled tumor protein GB:AAD10032 from [Hevea brasiliensis] Length = 168 Score = 119 bits (286), Expect = 2e-27 Identities = 70/174 (40%), Positives = 101/174 (58%), Gaps = 3/174 (1%) Frame = -2 Query: 661 MKIYKDIITGDEMFSDTYKMKLVDE-VIYEVTGRLVTRAQGDIQIEGFNPSAEEA--DEG 491 M +Y+D++TGDE+ SD++ K ++ +++EV G+ VT D+ I G NPSAEE DEG Sbjct: 1 MLVYQDLLTGDELLSDSFPYKEIENGILWEVEGKWVTVGAVDVNI-GANPSAEEGGEDEG 59 Query: 490 TDSAVESGVDIVLNHRLVETYAFGDKKSYTLYLKDYMKKLVAKLEEKAPDQVEVFKTNMN 311 D + + VDIV RL E + DKK + Y+K Y+K L KL E+ DQ VFK + Sbjct: 60 VDDSTQKVVDIVDTFRLQEQPTY-DKKGFIAYIKKYIKLLTPKLSEE--DQA-VFKKGIE 115 Query: 310 KVMKDILGRFKELQFFTGESMDCDGMVAMMEYRDFDGTQIPIMMFFKHGLEEEK 149 K +L R + QFF GE M D + Y+ +G+ P ++F HGL+E K Sbjct: 116 GATKFLLPRLSDFQFFVGEGMHDDSTLVFAYYK--EGSTNPTFLYFAHGLKEVK 167 >At3g05540.1 68416.m00607 translationally controlled tumor family protein similar to translationally controlled tumor protein GB:AAD10032 from [Hevea brasiliensis] Length = 156 Score = 95.1 bits (226), Expect = 4e-20 Identities = 61/174 (35%), Positives = 96/174 (55%), Gaps = 3/174 (1%) Frame = -2 Query: 661 MKIYKDIITGDEMFSDTYKMKLVDEVIYEVTGRLVTRAQGDIQIEGFNPSAEEA--DEGT 488 M +Y+DI+TGDE+ SD++ K ++ G L ++EG NPS EE DEG Sbjct: 1 MLVYQDILTGDELLSDSFPYKEIE------NGML-------WEVEGKNPSGEEGGEDEGV 47 Query: 487 DSAVESGVDIVLNHRLVETYAFGDKKSYTLYLKDYMKKLVAKLEEKAPDQVEVFKTNMNK 308 D VDI+ RL E +F DKK + +++K Y+K+L KL+ + E+FK ++ Sbjct: 48 DDQAVKVVDIIDTFRLQEQPSF-DKKQFVMFMKRYIKQLSPKLDS---ENQELFKKHIES 103 Query: 307 VMKDILGRFKELQFFTGESMDC-DGMVAMMEYRDFDGTQIPIMMFFKHGLEEEK 149 K ++ + K+ QFF GESM+ +G + YR +G P ++ +GL+E K Sbjct: 104 ATKFLMSKLKDFQFFVGESMEGEEGSLVFAYYR--EGATDPTFLYLAYGLKEIK 155 >At4g29060.1 68417.m04157 elongation factor Ts family protein similar to SP|P35019 Elongation factor Ts (EF-Ts) {Galdieria sulphuraria}; contains Pfam profiles PF00627: UBA/TS-N domain, PF00889: Elongation factor TS, PF00575: S1 RNA binding domain Length = 953 Score = 34.3 bits (75), Expect = 0.084 Identities = 21/58 (36%), Positives = 33/58 (56%), Gaps = 2/58 (3%) Frame = -2 Query: 634 GDEMFSDTYKMKLVDEVIYEVT--GRLVTRAQGDIQIEGFNPSAEEADEGTDSAVESG 467 G+ S K +++D V+ +T G +T +G+ EGF P+AEEAD+G S + G Sbjct: 238 GEGFNSKFAKGQMLDGVVKNLTRSGAFITIGEGE---EGFLPTAEEADDGIGSMMMGG 292 >At2g17050.1 68415.m01968 disease resistance protein (TIR-NBS-LRR class), putative domain signature TIR-NBS-LRR exists, suggestive of a disease resistance protein. Length = 1355 Score = 34.3 bits (75), Expect = 0.084 Identities = 25/91 (27%), Positives = 44/91 (48%), Gaps = 8/91 (8%) Frame = -2 Query: 493 GTDSAVESGVDIVLNHRLVETYAFGDKKSYTLYLK-------DYMKKLVAKLEEKAPDQV 335 G D +SG++ + + + Y G+ + +LY + D M+ + KL P + Sbjct: 184 GIDWRKQSGLETLAPYYISVKYFSGNPLALSLYEEMLSHMKSDKMEVKLLKLNHPPPQIM 243 Query: 334 EVFKTNMNKVMKDILGRFKELQ-FFTGESMD 245 EVFK+N N + ++ F ++ FF GE D Sbjct: 244 EVFKSNYNALNENEKSMFLDIACFFRGEKAD 274 >At1g76380.3 68414.m08876 DNA-binding bromodomain-containing protein contains bromodomain, INTERPRO:IPR001487 Length = 579 Score = 29.9 bits (64), Expect = 1.8 Identities = 22/84 (26%), Positives = 32/84 (38%), Gaps = 6/84 (7%) Frame = -2 Query: 544 GDIQIEGFNPSAEEADEGTDSAVESGVDIVLNHRLVETYAFGDKKSYTLYLKDYMKKLVA 365 GD+ + N + + T DI+L LVE+ DKK L KK Sbjct: 103 GDLDSDARNRRKIDGSDNTGEKASKATDILLQRSLVESTPLPDKKLLFFILDRVQKKDTY 162 Query: 364 KL------EEKAPDQVEVFKTNMN 311 + E+ PD E+ K M+ Sbjct: 163 GVYSDPADPEELPDYYEIIKNPMD 186 >At1g76380.1 68414.m08874 DNA-binding bromodomain-containing protein contains bromodomain, INTERPRO:IPR001487 Length = 579 Score = 29.9 bits (64), Expect = 1.8 Identities = 22/84 (26%), Positives = 32/84 (38%), Gaps = 6/84 (7%) Frame = -2 Query: 544 GDIQIEGFNPSAEEADEGTDSAVESGVDIVLNHRLVETYAFGDKKSYTLYLKDYMKKLVA 365 GD+ + N + + T DI+L LVE+ DKK L KK Sbjct: 103 GDLDSDARNRRKIDGSDNTGEKASKATDILLQRSLVESTPLPDKKLLFFILDRVQKKDTY 162 Query: 364 KL------EEKAPDQVEVFKTNMN 311 + E+ PD E+ K M+ Sbjct: 163 GVYSDPADPEELPDYYEIIKNPMD 186 >At1g63910.1 68414.m07236 myb family transcription factor (MYB103) contains Pfam profile: PF00249 myb-like DNA-binding domain Length = 370 Score = 29.1 bits (62), Expect = 3.2 Identities = 17/52 (32%), Positives = 23/52 (44%) Frame = +2 Query: 551 SRHQPTGHFVNNFIDQFHFVSVREHLITSDNVLIDLHFDGLEAIKNNKNRXN 706 SRHQP+ V D + E T+ + + +LHFDG N N N Sbjct: 124 SRHQPSVTTVTLNADTTSIATTIEASTTTTSTIDNLHFDGFTDSPNQLNFTN 175 >At5g49030.1 68418.m06067 tRNA synthetase class I (I, L, M and V) family protein similar to SP|P41972 Isoleucyl-tRNA synthetase (EC 6.1.1.5) (Isoleucine--tRNA ligase) (IleRS) {Staphylococcus aureus}; contains Pfam profile PF00133: tRNA synthetases class I (I, L, M and V) Length = 1093 Score = 27.5 bits (58), Expect = 9.6 Identities = 12/31 (38%), Positives = 20/31 (64%), Gaps = 3/31 (9%) Frame = -2 Query: 316 MNKVMKDILGRFKELQFFTGE---SMDCDGM 233 +NK++KDI+ R+K LQ + + DC G+ Sbjct: 167 LNKILKDIINRYKLLQNYKVQYVPGWDCHGL 197 >At5g42270.1 68418.m05145 FtsH protease, putative similar to FtsH protease GI:13183728 from [Medicago sativa] Length = 704 Score = 27.5 bits (58), Expect = 9.6 Identities = 16/51 (31%), Positives = 26/51 (50%), Gaps = 2/51 (3%) Frame = -2 Query: 523 FNPSAEEADEG--TDSAVESGVDIVLNHRLVETYAFGDKKSYTLYLKDYMK 377 F PS E + G + S +E+ + + L R+ E FGD+ T D+M+ Sbjct: 546 FAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGDENVTTGASNDFMQ 596 >At1g50250.1 68414.m05634 cell division protein ftsH homolog 1, chloroplast (FTSH1) (FTSH) identical to SP:Q39102 Cell division protein ftsH homolog 1, chloroplast precursor (EC 3.4.24.-) [Arabidopsis thaliana] Length = 716 Score = 27.5 bits (58), Expect = 9.6 Identities = 16/51 (31%), Positives = 26/51 (50%), Gaps = 2/51 (3%) Frame = -2 Query: 523 FNPSAEEADEG--TDSAVESGVDIVLNHRLVETYAFGDKKSYTLYLKDYMK 377 F PS E + G + S +E+ + + L R+ E FGD+ T D+M+ Sbjct: 558 FAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGDENVTTGASNDFMQ 608 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,965,731 Number of Sequences: 28952 Number of extensions: 296781 Number of successful extensions: 861 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 833 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 855 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1594686376 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -