BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV12h16f (501 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_56478| Best HMM Match : Trypsin (HMM E-Value=0) 33 0.10 SB_15907| Best HMM Match : Aldedh (HMM E-Value=3.2e-23) 33 0.17 SB_50354| Best HMM Match : Trypsin (HMM E-Value=0.0028) 33 0.17 SB_42973| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.53 SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.71 SB_43527| Best HMM Match : Trypsin (HMM E-Value=0) 30 1.2 SB_48258| Best HMM Match : Kelch_1 (HMM E-Value=0) 28 5.0 SB_22064| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.0 SB_41561| Best HMM Match : Merozoite_SPAM (HMM E-Value=0.28) 27 8.7 SB_37182| Best HMM Match : DUF225 (HMM E-Value=1) 27 8.7 SB_36384| Best HMM Match : Keratin_B2 (HMM E-Value=2.3) 27 8.7 SB_24224| Best HMM Match : Lectin_C (HMM E-Value=0) 27 8.7 SB_15415| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.7 SB_13096| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.7 SB_11235| Best HMM Match : Trypsin (HMM E-Value=1.1e-08) 27 8.7 >SB_56478| Best HMM Match : Trypsin (HMM E-Value=0) Length = 968 Score = 33.5 bits (73), Expect = 0.10 Identities = 14/76 (18%), Positives = 35/76 (46%), Gaps = 3/76 (3%) Frame = +2 Query: 185 CAGIVLTNYHYLSTATCFHGEFYDPAYRRIIAGSSRRSEPGEISYVHFA---VNHPEFSE 355 C G +++ ++ A C G + P+Y +++ G R+ P H + HP ++ Sbjct: 93 CGGSLVSPTWVVTAAHCIAGSSHTPSY-KVVTGEHIRNSPEGTEQTHDVKRIITHPTYNS 151 Query: 356 ENYDKDVSIVRVTHAI 403 D++++ ++ + Sbjct: 152 PQLSNDIALIELSSPV 167 >SB_15907| Best HMM Match : Aldedh (HMM E-Value=3.2e-23) Length = 275 Score = 32.7 bits (71), Expect = 0.17 Identities = 18/56 (32%), Positives = 30/56 (53%), Gaps = 1/56 (1%) Frame = -3 Query: 340 MVNSK-VNIRYFTGLTATGRSSDNATVCRIVEFSMETGSS*KVVVVGENNTSALLE 176 M+NS+ +N FTG TGR AT +V+ +E GS ++V+ + + +E Sbjct: 215 MINSRGINALTFTGSLETGRKVAAATAVNLVKCQLEMGSKNALIVLDDADLDNAVE 270 >SB_50354| Best HMM Match : Trypsin (HMM E-Value=0.0028) Length = 333 Score = 32.7 bits (71), Expect = 0.17 Identities = 20/66 (30%), Positives = 32/66 (48%), Gaps = 3/66 (4%) Frame = +2 Query: 146 EVFLPILNQW--FQQCAGIVLTNYHYLSTATCFH-GEFYDPAYRRIIAGSSRRSEPGEIS 316 E F+ + W QC+G ++ H ++ A C H G+++ I+ G S S E+ Sbjct: 138 EPFVSSVKLWSDVMQCSGTLIGPCHVITAAHCIHNGKWFVSPLTAILVGVSNTSSTDELD 197 Query: 317 YVHFAV 334 Y FAV Sbjct: 198 Y--FAV 201 >SB_42973| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1864 Score = 31.1 bits (67), Expect = 0.53 Identities = 20/91 (21%), Positives = 41/91 (45%), Gaps = 3/91 (3%) Frame = +2 Query: 146 EVFLPILNQWFQQCAGIVLTNYHYLSTATCFHGEFYDPAYRRIIAGSS---RRSEPGEIS 316 +V L + Q+C G ++ L+ A CF F P + G S RR G+ Sbjct: 1253 QVALTLSGNPVQRCGGALIAADWVLTAAHCF-DRFSMPPEWTVQVGVSDMRRRDGKGQSL 1311 Query: 317 YVHFAVNHPEFSEENYDKDVSIVRVTHAIHF 409 + HP+++ +++ D++++++ F Sbjct: 1312 SIKAIFVHPQYNSSSHEHDLAVLQLQQPAEF 1342 >SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 30.7 bits (66), Expect = 0.71 Identities = 12/80 (15%), Positives = 34/80 (42%), Gaps = 2/80 (2%) Frame = +2 Query: 176 FQQCAGIVLTNYHYLSTATCFHGEFYDPAYRRIIAGSSRRSEPGEISYVHFA--VNHPEF 349 F C G ++++ ++ A C H Y ++ +R + + + HP++ Sbjct: 129 FHTCGGSLISDRWVVTAAHCIHRNKNPGGYTVVVGAHKKRGSTSVQQSLRLSQIIEHPKY 188 Query: 350 SEENYDKDVSIVRVTHAIHF 409 ++ D++++ + + F Sbjct: 189 NDRRIVNDIALLELATPVQF 208 >SB_43527| Best HMM Match : Trypsin (HMM E-Value=0) Length = 366 Score = 29.9 bits (64), Expect = 1.2 Identities = 8/24 (33%), Positives = 17/24 (70%) Frame = +2 Query: 338 HPEFSEENYDKDVSIVRVTHAIHF 409 HP +S ++YD D++++R+ + F Sbjct: 199 HPHYSPDSYDSDIALIRLAQPVTF 222 >SB_48258| Best HMM Match : Kelch_1 (HMM E-Value=0) Length = 473 Score = 27.9 bits (59), Expect = 5.0 Identities = 14/41 (34%), Positives = 22/41 (53%) Frame = +2 Query: 131 SLVQIEVFLPILNQWFQQCAGIVLTNYHYLSTATCFHGEFY 253 +LV +E + P N+W ++ +LT Y STA G+ Y Sbjct: 111 NLVSMERYDPSTNEWEEEAVAPMLTARKYFSTAV-LDGKLY 150 >SB_22064| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 398 Score = 27.9 bits (59), Expect = 5.0 Identities = 15/51 (29%), Positives = 25/51 (49%) Frame = +3 Query: 201 SPTTTTFQLLPVSMENSTILHTVALSLDLPVAVSPVKYLMFTLLLTIPNSL 353 SP+T+ Q++P + + L T + S +LPV + FT IP + Sbjct: 143 SPSTSVKQMVPNTQASRLCLQTTSASSNLPVTTQQSFRMTFTPPSMIPKPI 193 >SB_41561| Best HMM Match : Merozoite_SPAM (HMM E-Value=0.28) Length = 1643 Score = 27.1 bits (57), Expect = 8.7 Identities = 12/28 (42%), Positives = 15/28 (53%) Frame = -1 Query: 87 VQLQTAASTATAKVRTETIVPIESNGDL 4 V ++T TA K E P+ESN DL Sbjct: 342 VSMETEDGTANPKADVEMDAPVESNNDL 369 >SB_37182| Best HMM Match : DUF225 (HMM E-Value=1) Length = 1282 Score = 27.1 bits (57), Expect = 8.7 Identities = 19/60 (31%), Positives = 25/60 (41%), Gaps = 2/60 (3%) Frame = +1 Query: 208 LPLPFNCYLFPWRILRS-CIPSHYRW-IFPSQ*AR*NILCSLCC*PSRIL*GELRQGCEH 381 +P+ +C P +L S C PS +FP I CS C P R+L C H Sbjct: 755 IPIACSCRCVPHHVLMSMCFPSRAHVDVFP-------ITCSCRCVPHRVLMSMCSPSCAH 807 >SB_36384| Best HMM Match : Keratin_B2 (HMM E-Value=2.3) Length = 199 Score = 27.1 bits (57), Expect = 8.7 Identities = 8/19 (42%), Positives = 10/19 (52%) Frame = -1 Query: 480 RSTKIPWGITTPCWIIAPC 424 R T + W PCW+ PC Sbjct: 137 RDTVLSWSPMIPCWVGTPC 155 >SB_24224| Best HMM Match : Lectin_C (HMM E-Value=0) Length = 2726 Score = 27.1 bits (57), Expect = 8.7 Identities = 14/31 (45%), Positives = 18/31 (58%) Frame = +3 Query: 126 IPAWSKLKYSYPS*INGSNSALVLFSPTTTT 218 IP+WS L S+PS + +SA SP TT Sbjct: 862 IPSWSSLSSSFPSLSSRLSSASSSASPPGTT 892 >SB_15415| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1390 Score = 27.1 bits (57), Expect = 8.7 Identities = 15/53 (28%), Positives = 29/53 (54%), Gaps = 1/53 (1%) Frame = -1 Query: 165 KMGRNTSIWTRLGC-SPIDTGLPRSLAVQLQTAASTATAKVRTETIVPIESNG 10 K+G+ TS + + + G+P S ++++TA ++ K+R P+E NG Sbjct: 579 KLGKFTSYRVSVSAFTSVGDGVP-SAEMKIKTAEDISSRKIRVRWDTPMEPNG 630 >SB_13096| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1465 Score = 27.1 bits (57), Expect = 8.7 Identities = 8/19 (42%), Positives = 14/19 (73%) Frame = +2 Query: 335 NHPEFSEENYDKDVSIVRV 391 +HP FS YD D++++R+ Sbjct: 1249 SHPRFSWRTYDSDIALIRL 1267 >SB_11235| Best HMM Match : Trypsin (HMM E-Value=1.1e-08) Length = 235 Score = 27.1 bits (57), Expect = 8.7 Identities = 19/72 (26%), Positives = 35/72 (48%), Gaps = 2/72 (2%) Frame = +2 Query: 185 CAGIVLTNYHYLSTATCFHGEFYDPAYRRIIAGSSRRSEPG--EISYVHFAVNHPEFSEE 358 C +L+ L+ A C +PA + AG+ RR ++ V ++H EFS Sbjct: 111 CGASLLSPGWALTAAHCVQRSS-NPADYTLAAGAHRRVNDAHAQVLRVSQVISHKEFSMG 169 Query: 359 NYDKDVSIVRVT 394 + DV+++R++ Sbjct: 170 HLRNDVTLLRLS 181 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,019,429 Number of Sequences: 59808 Number of extensions: 384672 Number of successful extensions: 953 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 875 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 952 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1087245449 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -