BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV12h15r (711 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292323-1|CAL23135.2| 587|Tribolium castaneum gustatory recept... 24 1.4 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 23 3.2 DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad... 21 7.5 AM292380-1|CAL23192.2| 489|Tribolium castaneum gustatory recept... 21 9.9 >AM292323-1|CAL23135.2| 587|Tribolium castaneum gustatory receptor candidate 2 protein. Length = 587 Score = 23.8 bits (49), Expect = 1.4 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +1 Query: 352 RINDKIMPTTGKNFRDYSNGTMGSLHDYYMKKKC 453 +I + + TGKNF + G + S DY++ C Sbjct: 370 QIGNSDIAITGKNFFSITRGLILSFVDYFVFLLC 403 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 22.6 bits (46), Expect = 3.2 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = +2 Query: 569 KRKICSRQKSVKCQSQ 616 +RKIC KS KC+ + Sbjct: 1140 ERKICDWPKSAKCEEK 1155 >DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome adhesion molecule splicevariant 3.12.3.1 protein. Length = 1639 Score = 21.4 bits (43), Expect = 7.5 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = +2 Query: 458 VQSTHVRSETFLAN*FVSLAYIYTNL 535 VQSTHV + T LA+ S+ T+L Sbjct: 668 VQSTHVGNYTCLASNSASVTTYTTSL 693 >AM292380-1|CAL23192.2| 489|Tribolium castaneum gustatory receptor candidate 59 protein. Length = 489 Score = 21.0 bits (42), Expect = 9.9 Identities = 7/25 (28%), Positives = 15/25 (60%) Frame = -1 Query: 369 YFVVYSLQLTCFLNKIHNIKNTLRH 295 + + Y +L ++K+H + N L+H Sbjct: 96 FCLFYQNKLIEVISKLHKLDNKLKH 120 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 149,900 Number of Sequences: 336 Number of extensions: 3089 Number of successful extensions: 7 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18843005 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -