BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV12h15r (711 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_03_0195 - 9560885-9561435,9561553-9561639,9562199-9563225 30 2.1 01_05_0637 + 23860857-23860936,23861057-23861273,23861388-238615... 29 4.8 >05_03_0195 - 9560885-9561435,9561553-9561639,9562199-9563225 Length = 554 Score = 29.9 bits (64), Expect = 2.1 Identities = 14/39 (35%), Positives = 22/39 (56%) Frame = +1 Query: 541 LDFRDLERGKKKDMFPPKVCQMSISNLSVDSHIMFRFLN 657 +DFRDL + KD +P + M I++ S H + FL+ Sbjct: 160 IDFRDLNKATPKDEYPMPIADMMINDAS--GHKVISFLD 196 >01_05_0637 + 23860857-23860936,23861057-23861273,23861388-23861549, 23862850-23863155 Length = 254 Score = 28.7 bits (61), Expect = 4.8 Identities = 18/57 (31%), Positives = 31/57 (54%) Frame = -1 Query: 492 KKVSLLTCVLCTHALFFHIIIM*RPHCSIRIISKVFASRRHYFVVYSLQLTCFLNKI 322 KK S++ +LC +FF I+ P + I+ KV ++ ++ + L L CFLN + Sbjct: 128 KKRSMIVGILC---VFFGSIMYFSP---LTIMGKVIKTKSVEYMPFFLSLVCFLNGV 178 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,285,930 Number of Sequences: 37544 Number of extensions: 243909 Number of successful extensions: 360 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 359 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 360 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1839213168 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -