BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV12h15f (611 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC051291-1|AAH51291.1| 305|Homo sapiens RDH11 protein protein. 29 9.8 >BC051291-1|AAH51291.1| 305|Homo sapiens RDH11 protein protein. Length = 305 Score = 29.5 bits (63), Expect = 9.8 Identities = 17/50 (34%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = +1 Query: 151 IIMTVTLLLLCCASSAPTPRIFETLVSGITTG-LELPMSIIAGTGVGTGA 297 ++ + LLLL P+I + L SG+ T ++LP ++ TG TGA Sbjct: 4 LMFPLLLLLLPFLLYMAAPQIRKMLSSGVCTSTVQLPGKVVVVTGANTGA 53 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 77,292,164 Number of Sequences: 237096 Number of extensions: 1610337 Number of successful extensions: 3103 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 2970 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3101 length of database: 76,859,062 effective HSP length: 87 effective length of database: 56,231,710 effective search space used: 6522878360 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -