SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fmgV12h15f
         (611 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

BC051291-1|AAH51291.1|  305|Homo sapiens RDH11 protein protein.        29   9.8  

>BC051291-1|AAH51291.1|  305|Homo sapiens RDH11 protein protein.
          Length = 305

 Score = 29.5 bits (63), Expect = 9.8
 Identities = 17/50 (34%), Positives = 27/50 (54%), Gaps = 1/50 (2%)
 Frame = +1

Query: 151 IIMTVTLLLLCCASSAPTPRIFETLVSGITTG-LELPMSIIAGTGVGTGA 297
           ++  + LLLL        P+I + L SG+ T  ++LP  ++  TG  TGA
Sbjct: 4   LMFPLLLLLLPFLLYMAAPQIRKMLSSGVCTSTVQLPGKVVVVTGANTGA 53


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 77,292,164
Number of Sequences: 237096
Number of extensions: 1610337
Number of successful extensions: 3103
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 2970
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3101
length of database: 76,859,062
effective HSP length: 87
effective length of database: 56,231,710
effective search space used: 6522878360
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -