BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV12h10r (384 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_35451| Best HMM Match : Ribosomal_L36e (HMM E-Value=0) 125 1e-29 SB_19393| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.14 SB_13913| Best HMM Match : WH2 (HMM E-Value=8.8e-05) 29 0.98 SB_6230| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 0.98 SB_45611| Best HMM Match : p450 (HMM E-Value=0) 28 2.3 SB_44702| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.03) 27 4.0 SB_27155| Best HMM Match : Dynein_heavy (HMM E-Value=1.1e-09) 27 4.0 SB_26477| Best HMM Match : GST_C (HMM E-Value=0.97) 27 4.0 SB_14664| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.0 SB_31885| Best HMM Match : RVT_1 (HMM E-Value=4.6e-28) 27 5.2 SB_24| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.9 SB_56590| Best HMM Match : Pox_A32 (HMM E-Value=6.1) 26 9.2 SB_30986| Best HMM Match : 7tm_1 (HMM E-Value=0) 26 9.2 SB_786| Best HMM Match : EGF (HMM E-Value=0) 26 9.2 SB_39349| Best HMM Match : 7tm_1 (HMM E-Value=0) 26 9.2 SB_36025| Best HMM Match : LHC (HMM E-Value=2.9) 26 9.2 >SB_35451| Best HMM Match : Ribosomal_L36e (HMM E-Value=0) Length = 100 Score = 125 bits (302), Expect = 1e-29 Identities = 64/110 (58%), Positives = 77/110 (70%) Frame = -1 Query: 330 IAVGLRKGHKTTKISAGRKGITDKAIRIRPARLKGLQTKHSKFVRDLVREVVGHAQYEKR 151 +AVGL+KGHK TK + +P+R KG K KFVRD+VREVVG A YEKR Sbjct: 1 MAVGLQKGHKVTK----------NVTKPKPSRRKGASNKRVKFVRDVVREVVGFAPYEKR 50 Query: 150 AMELLKVSKDKRALKFLKRRLGTHIRAKRKREELSNVLAQMRKAAAQAHH 1 MELL++ KDKRALKF K+RLGTH+R KRKREE+++VLA MRK Q H Sbjct: 51 VMELLRIGKDKRALKFCKKRLGTHVRGKRKREEITSVLAAMRKQQQQQQH 100 >SB_19393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1660 Score = 32.3 bits (70), Expect = 0.14 Identities = 35/120 (29%), Positives = 55/120 (45%), Gaps = 15/120 (12%) Frame = -1 Query: 324 VGLRKGHKTT-----KISAGRKGITDKAIRIRPARLKGLQ----TKHS---KFVRDLVRE 181 V RKGHK T + G+KGI K R+ +R Q KHS K +R +RE Sbjct: 1109 VSTRKGHKRTENYNDRKRDGKKGIDGKRERLSSSRSDDFQQSKMIKHSHLEKSLRQAMRE 1168 Query: 180 VVGHAQYEKRAMELLKVSKDKRALKFLKRRLGTHIR---AKRKREELSNVLAQMRKAAAQ 10 + H+ E KV K K+ ++F K + G ++ KR+++ V++ +Q Sbjct: 1169 -LEHSSENSSEEEKRKVRK-KKLVEF-KNKHGLDVKKMDESEKRKKVQQVMSMFNSTVSQ 1225 >SB_13913| Best HMM Match : WH2 (HMM E-Value=8.8e-05) Length = 493 Score = 29.5 bits (63), Expect = 0.98 Identities = 30/99 (30%), Positives = 50/99 (50%), Gaps = 4/99 (4%) Frame = -1 Query: 351 IMAPRFEIAVGLRKGHKTTKISAGRKGITD---KAIRIRPARLKGLQTKHSKFVRDLVRE 181 + AP+ E V K K K+S ++ + +AI A LK + K + +R++++ Sbjct: 267 LSAPQNEEKVETPKSSKKEKLSELKRRLATPMREAIEAGIA-LKQTKKKLATPLREVIKS 325 Query: 180 VVGHAQYEKR-AMELLKVSKDKRALKFLKRRLGTHIRAK 67 + +K+ A L K + K ALK K+RL T IRA+ Sbjct: 326 KPKLKETKKKLATPLRKEIQSKPALKETKKRLATPIRAE 364 >SB_6230| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 191 Score = 29.5 bits (63), Expect = 0.98 Identities = 13/38 (34%), Positives = 22/38 (57%) Frame = -1 Query: 231 KGLQTKHSKFVRDLVREVVGHAQYEKRAMELLKVSKDK 118 +GL+ K + ++ E GHA Y+K L KVS+++ Sbjct: 32 RGLRKVSRKHAQRILDETAGHASYKKEHRGLRKVSREQ 69 Score = 29.5 bits (63), Expect = 0.98 Identities = 20/61 (32%), Positives = 29/61 (47%) Frame = -1 Query: 231 KGLQTKHSKFVRDLVREVVGHAQYEKRAMELLKVSKDKRALKFLKRRLGTHIRAKRKREE 52 +GL+ K R ++ E GH Y+K L KVS+ K A + L G H K++ Sbjct: 88 RGLRKVSRKHARRILDETAGHNTYKKEHRGLRKVSR-KHAQRILDGTAG-HCSYKKEHRG 145 Query: 51 L 49 L Sbjct: 146 L 146 Score = 28.7 bits (61), Expect = 1.7 Identities = 17/58 (29%), Positives = 27/58 (46%) Frame = -1 Query: 231 KGLQTKHSKFVRDLVREVVGHAQYEKRAMELLKVSKDKRALKFLKRRLGTHIRAKRKR 58 +GL+ + + ++ E GH Y+K L KVS+ K A + L G + K R Sbjct: 60 RGLRKVSREQAQRIIDETAGHGSYKKEYRGLRKVSR-KHARRILDETAGHNTYKKEHR 116 Score = 27.5 bits (58), Expect = 4.0 Identities = 17/51 (33%), Positives = 24/51 (47%) Frame = -1 Query: 192 LVREVVGHAQYEKRAMELLKVSKDKRALKFLKRRLGTHIRAKRKREELSNV 40 ++ E GH Y+K L KVS+ K A + L G H K++ L V Sbjct: 17 ILNETAGHGSYKKEHRGLRKVSR-KHAQRILDETAG-HASYKKEHRGLRKV 65 >SB_45611| Best HMM Match : p450 (HMM E-Value=0) Length = 847 Score = 28.3 bits (60), Expect = 2.3 Identities = 16/29 (55%), Positives = 18/29 (62%) Frame = -1 Query: 129 SKDKRALKFLKRRLGTHIRAKRKREELSN 43 +K RALKFLK RL +R KR E L N Sbjct: 59 NKSPRALKFLKTRL-QDLRKKRDSETLRN 86 >SB_44702| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.03) Length = 307 Score = 27.5 bits (58), Expect = 4.0 Identities = 19/77 (24%), Positives = 36/77 (46%) Frame = -1 Query: 234 LKGLQTKHSKFVRDLVREVVGHAQYEKRAMELLKVSKDKRALKFLKRRLGTHIRAKRKRE 55 +K ++ +H V L +E + Y +L + KDK LK+ K +R K++ Sbjct: 140 IKSIKEQHDTEVEKLEKET---SDYLASLRQLKQELKDKE-LKYEKDMESLRVRCKKQAC 195 Query: 54 ELSNVLAQMRKAAAQAH 4 + + +++ KA Q H Sbjct: 196 SIKELKSELLKAQDQIH 212 >SB_27155| Best HMM Match : Dynein_heavy (HMM E-Value=1.1e-09) Length = 1248 Score = 27.5 bits (58), Expect = 4.0 Identities = 13/44 (29%), Positives = 24/44 (54%) Frame = -1 Query: 246 RPARLKGLQTKHSKFVRDLVREVVGHAQYEKRAMELLKVSKDKR 115 RP +L+ ++ + +VR L + G +Y + L++ SKD R Sbjct: 625 RPNKLQVIKLSDANYVRTLENSIQGGIEYLRLGDHLVEFSKDFR 668 >SB_26477| Best HMM Match : GST_C (HMM E-Value=0.97) Length = 971 Score = 27.5 bits (58), Expect = 4.0 Identities = 14/41 (34%), Positives = 20/41 (48%) Frame = +3 Query: 87 PIVASRTSEHACLLTP*VTP*PSSHIERVRQLRVLNHGQTW 209 P +S A L+ P PS ++ R+ R NHG+TW Sbjct: 772 PTERDYSSALAALMRKAKQPKPSPNLVHTRRERPRNHGRTW 812 >SB_14664| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 27.5 bits (58), Expect = 4.0 Identities = 12/45 (26%), Positives = 27/45 (60%) Frame = -1 Query: 186 REVVGHAQYEKRAMELLKVSKDKRALKFLKRRLGTHIRAKRKREE 52 RE+ + + + E++K+ K K++ K +K++ + K+K+EE Sbjct: 3 REINQKDKKQIKKEEIIKIKKKKKSKKKIKKKKKKKKKKKKKKEE 47 >SB_31885| Best HMM Match : RVT_1 (HMM E-Value=4.6e-28) Length = 922 Score = 27.1 bits (57), Expect = 5.2 Identities = 16/54 (29%), Positives = 30/54 (55%), Gaps = 1/54 (1%) Frame = -1 Query: 267 TDKAIRIRPARLKGLQTKHSKFVRDLVREVVGHAQY-EKRAMELLKVSKDKRAL 109 TDK +++ PA+++ + S + V+ ++G AQY K +L ++K R L Sbjct: 659 TDKGLKVDPAKVRAIVDMPSPTDKLGVQRLLGLAQYLAKSCPQLSDITKPLRDL 712 >SB_24| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1246 Score = 26.6 bits (56), Expect = 6.9 Identities = 16/54 (29%), Positives = 30/54 (55%), Gaps = 1/54 (1%) Frame = -1 Query: 267 TDKAIRIRPARLKGLQTKHSKFVRDLVREVVGHAQY-EKRAMELLKVSKDKRAL 109 TDK +++ PA+++ + S + V+ ++G AQY K +L ++K R L Sbjct: 618 TDKGLKVNPAKVRAIVDMPSPTDKLGVQRLLGLAQYLAKFLPQLSDITKPLRDL 671 >SB_56590| Best HMM Match : Pox_A32 (HMM E-Value=6.1) Length = 740 Score = 26.2 bits (55), Expect = 9.2 Identities = 12/34 (35%), Positives = 17/34 (50%) Frame = +3 Query: 30 SERARC*VLHASSWRGCVCPIVASRTSEHACLLT 131 S +C S+W GC AS T+ ++C LT Sbjct: 233 STDTKCAKRCGSAWTGCAALSGASLTTSYSCALT 266 >SB_30986| Best HMM Match : 7tm_1 (HMM E-Value=0) Length = 2682 Score = 26.2 bits (55), Expect = 9.2 Identities = 13/35 (37%), Positives = 20/35 (57%) Frame = +2 Query: 230 FSLAGLILMALSVIPLRPADILVVLWPFRRPTAIS 334 FS A + L+V+ + + I+V LW +RP A S Sbjct: 211 FSFAFFYAIPLAVVIVLYSAIMVTLWMHKRPGAFS 245 >SB_786| Best HMM Match : EGF (HMM E-Value=0) Length = 1427 Score = 26.2 bits (55), Expect = 9.2 Identities = 11/44 (25%), Positives = 23/44 (52%) Frame = -1 Query: 192 LVREVVGHAQYEKRAMELLKVSKDKRALKFLKRRLGTHIRAKRK 61 L R V+ Y+ + + + ++ ++FL +RL ++ KRK Sbjct: 1235 LTRNVIYRNPYQPITYDYRTIGEQRQRVRFLAKRLSKILKRKRK 1278 >SB_39349| Best HMM Match : 7tm_1 (HMM E-Value=0) Length = 1125 Score = 26.2 bits (55), Expect = 9.2 Identities = 13/35 (37%), Positives = 20/35 (57%) Frame = +2 Query: 230 FSLAGLILMALSVIPLRPADILVVLWPFRRPTAIS 334 FS A + L+V+ + + I+V LW +RP A S Sbjct: 954 FSFAFFYAIPLAVVIVLYSAIMVTLWMHKRPGAFS 988 >SB_36025| Best HMM Match : LHC (HMM E-Value=2.9) Length = 671 Score = 26.2 bits (55), Expect = 9.2 Identities = 12/34 (35%), Positives = 17/34 (50%) Frame = +3 Query: 30 SERARC*VLHASSWRGCVCPIVASRTSEHACLLT 131 S +C S+W GC AS T+ ++C LT Sbjct: 153 STDTKCAKRCGSAWTGCAALSGASLTTSYSCALT 186 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,850,494 Number of Sequences: 59808 Number of extensions: 222815 Number of successful extensions: 623 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 566 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 622 length of database: 16,821,457 effective HSP length: 74 effective length of database: 12,395,665 effective search space used: 656970245 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -