BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV12h02r (707 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g60170.1 68418.m07543 RNA recognition motif (RRM)-containing ... 33 0.14 At1g23540.1 68414.m02960 protein kinase family protein contains ... 30 1.7 At5g18230.1 68418.m02139 transcription regulator NOT2/NOT3/NOT5 ... 29 4.0 At4g11430.1 68417.m01841 hydroxyproline-rich glycoprotein family... 28 5.3 At3g13980.1 68416.m01765 expressed protein 28 5.3 At1g10620.1 68414.m01204 protein kinase family protein contains ... 28 5.3 At5g65500.1 68418.m08240 protein kinase family protein contains ... 28 7.0 At5g36905.1 68418.m04423 RNase H domain-containing protein low s... 28 7.0 At3g24540.1 68416.m03082 protein kinase family protein contains ... 28 7.0 At1g72410.1 68414.m08374 COP1-interacting protein-related simila... 28 7.0 At1g56720.2 68414.m06524 protein kinase family protein contains ... 28 7.0 At1g56720.1 68414.m06523 protein kinase family protein contains ... 28 7.0 >At5g60170.1 68418.m07543 RNA recognition motif (RRM)-containing protein low similarity to transcriptional repressor Not4-Np [Homo sapiens] GI:6856207; contains INTERPRO:IPR000504 RNA-binding region RNP-1 (RNA recognition motif) Length = 944 Score = 33.5 bits (73), Expect = 0.14 Identities = 22/59 (37%), Positives = 28/59 (47%), Gaps = 11/59 (18%) Frame = -1 Query: 239 IINPDVETPP--TAPNRRPPGGVSN---------TTDGARHADAIRVPNRSETPPPPYN 96 + P V PP +APNR PP G S+ TT G R D+ + N + PPP N Sbjct: 717 VSRPQVSAPPGFSAPNRLPPPGFSSHERVGLSSDTTLGNRFLDSTSLRNAYQVPPPVGN 775 >At1g23540.1 68414.m02960 protein kinase family protein contains Pfam domain, PF00069: Protein kinase domain Length = 720 Score = 29.9 bits (64), Expect = 1.7 Identities = 15/50 (30%), Positives = 24/50 (48%) Frame = -1 Query: 242 TIINPDVETPPTAPNRRPPGGVSNTTDGARHADAIRVPNRSETPPPPYNE 93 +I+ P ++PP + PP + + ++ P SETPP P NE Sbjct: 69 SILPPLTDSPPPPSDSSPPVDSTPSPPPPTSNESPSPPEDSETPPAPPNE 118 >At5g18230.1 68418.m02139 transcription regulator NOT2/NOT3/NOT5 family protein contains Pfam domain PF04153: NOT2 / NOT3 / NOT5 family Length = 843 Score = 28.7 bits (61), Expect = 4.0 Identities = 13/40 (32%), Positives = 21/40 (52%) Frame = -1 Query: 221 ETPPTAPNRRPPGGVSNTTDGARHADAIRVPNRSETPPPP 102 E T P+R+PP V++T R + +PN+ + PP Sbjct: 359 EDATTLPSRKPPSSVADTP--LRGIGRVGIPNQPQPSQPP 396 >At4g11430.1 68417.m01841 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965; related to hydroxyproline-rich glycoprotein [Phaseolus vulgaris] gi|169349|gb|AAA33765 Length = 219 Score = 28.3 bits (60), Expect = 5.3 Identities = 16/43 (37%), Positives = 17/43 (39%) Frame = -1 Query: 230 PDVETPPTAPNRRPPGGVSNTTDGARHADAIRVPNRSETPPPP 102 P PP P PP V+ TT G H P PPPP Sbjct: 122 PPPPPPPPPPTITPP--VTTTTAGHHHHRRSPPPPPPPPPPPP 162 >At3g13980.1 68416.m01765 expressed protein Length = 357 Score = 28.3 bits (60), Expect = 5.3 Identities = 11/43 (25%), Positives = 19/43 (44%) Frame = -2 Query: 214 HRRPLIEDHLVASLIRPMEPDTLTPSVSQTDPRLHHHHTMNAA 86 HR P L+ + R ++ + P + + HHH NA+ Sbjct: 14 HRNPSFSSTLLDQIYRSIDDSSPPPPLESIKKKKHHHQQRNAS 56 >At1g10620.1 68414.m01204 protein kinase family protein contains serine/threonine protein kinases active-site signature, PROSITE:PS00108 Length = 718 Score = 28.3 bits (60), Expect = 5.3 Identities = 14/39 (35%), Positives = 18/39 (46%), Gaps = 1/39 (2%) Frame = -1 Query: 215 PPTAP-NRRPPGGVSNTTDGARHADAIRVPNRSETPPPP 102 PP P N PG D ++ RVP+ S +P PP Sbjct: 186 PPMLPLNPNSPGNPLQPLDSPLGGESNRVPSSSSSPSPP 224 >At5g65500.1 68418.m08240 protein kinase family protein contains Pfam profile: PF00069 Eukaryotic protein kinase domain Length = 765 Score = 27.9 bits (59), Expect = 7.0 Identities = 18/65 (27%), Positives = 28/65 (43%), Gaps = 1/65 (1%) Frame = +3 Query: 120 GSVWDTDGVSVSGSIGRIRD-ATRWSSIRGRRWSFHIRIDDGTPK*IRSHFSIGTLQSAS 296 G D + +G+IR+ A + + G + + +D+G P I S F LQ Sbjct: 643 GGNMDFSTKEIMEELGKIREKADEFKTKGGYEEATNSNMDEGDPNDIPSVFMCPILQEVM 702 Query: 297 STPHV 311 PHV Sbjct: 703 KNPHV 707 >At5g36905.1 68418.m04423 RNase H domain-containing protein low similarity to reverse transcriptase [Arabidopsis thaliana] GI:976278; contains Pfam profile PF00075: RNase H Length = 633 Score = 27.9 bits (59), Expect = 7.0 Identities = 17/52 (32%), Positives = 23/52 (44%), Gaps = 1/52 (1%) Frame = +3 Query: 90 AFIVWWWWSLGSVWDTDGVSVSGSIGRIRDATRWSSIRGRR-WSFHIRIDDG 242 A +VWW W W +V G GR RD R+ + R W H+ + G Sbjct: 394 AIVVWWAWK----WRCG--NVFGENGRCRDRVRFVVDQAREIWIAHLNLRRG 439 >At3g24540.1 68416.m03082 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 509 Score = 27.9 bits (59), Expect = 7.0 Identities = 15/44 (34%), Positives = 17/44 (38%) Frame = -1 Query: 233 NPDVETPPTAPNRRPPGGVSNTTDGARHADAIRVPNRSETPPPP 102 +P TPP NR PP S G P S +PP P Sbjct: 77 SPSTSTPPRLGNRNPPPPAS--PSGQEPTTPTMTPGFSLSPPSP 118 >At1g72410.1 68414.m08374 COP1-interacting protein-related similar to COP1-Interacting ProteinI 7 (CIP7) [Arabidopsis thaliana] GI:3327870 Length = 1163 Score = 27.9 bits (59), Expect = 7.0 Identities = 18/38 (47%), Positives = 23/38 (60%), Gaps = 4/38 (10%) Frame = -1 Query: 218 TPPTAPN-RRPPGGVSNTTDGARHAD---AIRVPNRSE 117 TP +A + +P G VSNT+ G R +D A VPN SE Sbjct: 789 TPRSAASVPKPSGKVSNTSSGRRRSDKSLAQSVPNFSE 826 >At1g56720.2 68414.m06524 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 492 Score = 27.9 bits (59), Expect = 7.0 Identities = 13/41 (31%), Positives = 24/41 (58%) Frame = +1 Query: 331 AQEKNRRSQTYVPTMPIAKPISRPITRA*IAENSLSNFSRG 453 +++K+RRS+T +P + +S+ I + S SNF+ G Sbjct: 45 SKKKSRRSKTGLPVIQTPPVVSKEIREVRVEHVSASNFAPG 85 >At1g56720.1 68414.m06523 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 492 Score = 27.9 bits (59), Expect = 7.0 Identities = 13/41 (31%), Positives = 24/41 (58%) Frame = +1 Query: 331 AQEKNRRSQTYVPTMPIAKPISRPITRA*IAENSLSNFSRG 453 +++K+RRS+T +P + +S+ I + S SNF+ G Sbjct: 45 SKKKSRRSKTGLPVIQTPPVVSKEIREVRVEHVSASNFAPG 85 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,521,377 Number of Sequences: 28952 Number of extensions: 304916 Number of successful extensions: 1000 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 931 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 992 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1526202912 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -