BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV12g24f (521 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ211693-1|ABB16909.1| 314|Tribolium castaneum dorsocross protein. 27 0.10 AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr... 26 0.18 EF125547-1|ABL73931.1| 255|Tribolium castaneum obstractor D pro... 25 0.41 DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad... 21 5.0 DQ414247-1|ABD63009.2| 414|Tribolium castaneum paired protein. 21 6.6 >DQ211693-1|ABB16909.1| 314|Tribolium castaneum dorsocross protein. Length = 314 Score = 27.1 bits (57), Expect = 0.10 Identities = 16/46 (34%), Positives = 23/46 (50%) Frame = +3 Query: 168 GFDMSSENPPTDRDPSLNRPGSPKPKRSTKPDLPPPALKVPVNEKK 305 GF + ++ + P SP K+S P PPP L+ VNE+K Sbjct: 199 GFRENGKSSAKRKQLVSEHPDSPNSKKSATPS-PPPQLE--VNERK 241 >AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like protein protein. Length = 1156 Score = 26.2 bits (55), Expect = 0.18 Identities = 11/37 (29%), Positives = 19/37 (51%) Frame = +3 Query: 162 NNGFDMSSENPPTDRDPSLNRPGSPKPKRSTKPDLPP 272 N D+S + D S+++P + KP+ KP + P Sbjct: 239 NGPLDLSVSSRKRSNDDSVSQPPNRKPRTDFKPQVLP 275 >EF125547-1|ABL73931.1| 255|Tribolium castaneum obstractor D protein. Length = 255 Score = 25.0 bits (52), Expect = 0.41 Identities = 11/33 (33%), Positives = 16/33 (48%) Frame = +3 Query: 192 PPTDRDPSLNRPGSPKPKRSTKPDLPPPALKVP 290 PP + D N P + + +LPP A+ VP Sbjct: 216 PPPEEDDDSNIPQNNPKNKQHNFNLPPGAIPVP 248 >DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome adhesion molecule splicevariant 3.12.3.1 protein. Length = 1639 Score = 21.4 bits (43), Expect = 5.0 Identities = 9/34 (26%), Positives = 16/34 (47%) Frame = +3 Query: 258 PDLPPPALKVPVNEKKAFEDIEGAPERMMWSNQI 359 P PP +++V N++ + P R W+ I Sbjct: 995 PGGPPTSIRVETNDQHSLVVYWKPPAREEWNGDI 1028 >DQ414247-1|ABD63009.2| 414|Tribolium castaneum paired protein. Length = 414 Score = 21.0 bits (42), Expect = 6.6 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = +3 Query: 231 SPKPKRSTKPDLP 269 SP P ST P+LP Sbjct: 325 SPVPGHSTSPNLP 337 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 136,328 Number of Sequences: 336 Number of extensions: 3452 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 12573240 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -